BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060498.seq (687 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X63753-1|CAA45282.1| 1523|Homo sapiens son-a protein. 33 1.3 X63071-1|CAA44793.1| 1179|Homo sapiens DBP-5 protein protein. 33 1.3 M36428-1|AAA36624.1| 483|Homo sapiens protein ( Human son3 prot... 33 1.3 AY026895-1|AAK07692.1| 2386|Homo sapiens NREBP protein. 33 1.3 AF380184-1|AAL34502.1| 2426|Homo sapiens SON DNA binding protein... 33 1.3 AF380183-1|AAL34501.1| 2108|Homo sapiens SON DNA binding protein... 33 1.3 AF380181-1|AAL34499.1| 2325|Homo sapiens SON DNA binding protein... 33 1.3 AF380180-1|AAL34498.1| 2303|Homo sapiens SON DNA binding protein... 33 1.3 AF380179-1|AAL34497.1| 2140|Homo sapiens SON DNA binding protein... 33 1.3 AB028942-1|BAA82971.2| 2309|Homo sapiens KIAA1019 protein protein. 33 1.3 BC036187-1|AAH36187.1| 904|Homo sapiens serine/arginine repetit... 31 2.9 AL445686-4|CAI14682.1| 904|Homo sapiens serine/arginine repetit... 31 2.9 AL445686-3|CAI14683.1| 913|Homo sapiens serine/arginine repetit... 31 2.9 AL445648-3|CAH73090.1| 904|Homo sapiens serine/arginine repetit... 31 2.9 AL445648-2|CAH73089.1| 913|Homo sapiens serine/arginine repetit... 31 2.9 AF419855-1|AAP97290.1| 820|Homo sapiens Ser/Arg-related nuclear... 31 2.9 AF048977-1|AAC09321.1| 820|Homo sapiens Ser/Arg-related nuclear... 31 2.9 M60052-1|AAA88071.1| 699|Homo sapiens histidine-rich calcium bi... 30 6.7 BC112355-1|AAI12356.1| 699|Homo sapiens histidine-rich calcium-... 30 6.7 BC094691-1|AAH94691.1| 699|Homo sapiens histidine rich calcium ... 30 6.7 BC069802-1|AAH69802.1| 699|Homo sapiens histidine rich calcium ... 30 6.7 BC069795-1|AAH69795.1| 699|Homo sapiens histidine rich calcium ... 30 6.7 U82939-1|AAC98530.1| 815|Homo sapiens p53 binding protein protein. 30 8.9 BC060884-1|AAH60884.1| 1045|Homo sapiens topoisomerase I binding... 30 8.9 AL353671-4|CAH71253.1| 980|Homo sapiens topoisomerase I binding... 30 8.9 AL353671-3|CAH71254.1| 1045|Homo sapiens topoisomerase I binding... 30 8.9 AF293339-1|AAG26885.1| 218|Homo sapiens ornithine decarboxylase... 30 8.9 AF098300-1|AAD23379.1| 1045|Homo sapiens topoisomerase I-binding... 30 8.9 AB045733-1|BAB03715.1| 980|Homo sapiens RING-finger protein pro... 30 8.9 AB045732-1|BAB03714.1| 1045|Homo sapiens RING-finger protein pro... 30 8.9 >X63753-1|CAA45282.1| 1523|Homo sapiens son-a protein. Length = 1523 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 877 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 933 >X63071-1|CAA44793.1| 1179|Homo sapiens DBP-5 protein protein. Length = 1179 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 740 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 796 >M36428-1|AAA36624.1| 483|Homo sapiens protein ( Human son3 protein gene, partial cds. ). Length = 483 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 192 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 248 >AY026895-1|AAK07692.1| 2386|Homo sapiens NREBP protein. Length = 2386 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1844 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1900 >AF380184-1|AAL34502.1| 2426|Homo sapiens SON DNA binding protein isoform F protein. Length = 2426 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1884 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1940 >AF380183-1|AAL34501.1| 2108|Homo sapiens SON DNA binding protein isoform E protein. Length = 2108 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1884 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1940 >AF380181-1|AAL34499.1| 2325|Homo sapiens SON DNA binding protein isoform C protein. Length = 2325 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1884 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1940 >AF380180-1|AAL34498.1| 2303|Homo sapiens SON DNA binding protein isoform B protein. Length = 2303 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1884 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1940 >AF380179-1|AAL34497.1| 2140|Homo sapiens SON DNA binding protein isoform A protein. Length = 2140 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1565 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1621 >AB028942-1|BAA82971.2| 2309|Homo sapiens KIAA1019 protein protein. Length = 2309 Score = 32.7 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+V ++ HR + K S+S +R +V R RS TP R++ P RRS Sbjct: 1890 RSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTV--RARSRTPSRRSRSHTPSRRRRS 1946 >BC036187-1|AAH36187.1| 904|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 904 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSHSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >AL445686-4|CAI14682.1| 904|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 904 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >AL445686-3|CAI14683.1| 913|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 913 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >AL445648-3|CAH73090.1| 904|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 904 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >AL445648-2|CAH73089.1| 913|Homo sapiens serine/arginine repetitive matrix 1 protein. Length = 913 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >AF419855-1|AAP97290.1| 820|Homo sapiens Ser/Arg-related nuclear matrix protein protein. Length = 820 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >AF048977-1|AAC09321.1| 820|Homo sapiens Ser/Arg-related nuclear matrix protein protein. Length = 820 Score = 31.5 bits (68), Expect = 2.9 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 4/57 (7%) Frame = -1 Query: 351 RAVQSREQGHQDHHRGPAPRHSEKHSASEADRVSVCCRER----SETPRHRNKPSRP 193 R + +E + R +PR + S S R S RER S +PRHR K P Sbjct: 154 RDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRSHSRSPRHRTKSRSP 210 >M60052-1|AAA88071.1| 699|Homo sapiens histidine-rich calcium binding protein protein. Length = 699 Score = 30.3 bits (65), Expect = 6.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 327 GHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRSPHHFH 160 GH HHR P+ RH H + D V + RH++ V + HH H Sbjct: 287 GH--HHRDPSHRH-RSHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHH 339 >BC112355-1|AAI12356.1| 699|Homo sapiens histidine-rich calcium-binding protein, precursor protein. Length = 699 Score = 30.3 bits (65), Expect = 6.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 327 GHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRSPHHFH 160 GH HHR P+ RH H + D V + RH++ V + HH H Sbjct: 287 GH--HHRDPSHRH-RSHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHH 339 >BC094691-1|AAH94691.1| 699|Homo sapiens histidine rich calcium binding protein protein. Length = 699 Score = 30.3 bits (65), Expect = 6.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 327 GHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRSPHHFH 160 GH HHR P+ RH H + D V + RH++ V + HH H Sbjct: 287 GH--HHRDPSHRH-RSHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHH 339 >BC069802-1|AAH69802.1| 699|Homo sapiens histidine rich calcium binding protein protein. Length = 699 Score = 30.3 bits (65), Expect = 6.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 327 GHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRSPHHFH 160 GH HHR P+ RH H + D V + RH++ V + HH H Sbjct: 287 GH--HHRDPSHRH-RSHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHH 339 >BC069795-1|AAH69795.1| 699|Homo sapiens histidine rich calcium binding protein protein. Length = 699 Score = 30.3 bits (65), Expect = 6.7 Identities = 17/56 (30%), Positives = 23/56 (41%) Frame = -1 Query: 327 GHQDHHRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRSPHHFH 160 GH HHR P+ RH H + D V + RH++ V + HH H Sbjct: 287 GH--HHRDPSHRH-RSHEEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHH 339 >U82939-1|AAC98530.1| 815|Homo sapiens p53 binding protein protein. Length = 815 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 368 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 427 >BC060884-1|AAH60884.1| 1045|Homo sapiens topoisomerase I binding, arginine/serine-rich protein. Length = 1045 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 598 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 657 >AL353671-4|CAH71253.1| 980|Homo sapiens topoisomerase I binding, arginine/serine-rich protein. Length = 980 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 533 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 592 >AL353671-3|CAH71254.1| 1045|Homo sapiens topoisomerase I binding, arginine/serine-rich protein. Length = 1045 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 598 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 657 >AF293339-1|AAG26885.1| 218|Homo sapiens ornithine decarboxylase antizyme 4 protein. Length = 218 Score = 29.9 bits (64), Expect = 8.9 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 1/110 (0%) Frame = +2 Query: 344 TARRVTGRGCEPRYPGHPQPRRQSRLAKCPAMVKLQLFGQQRRESP*WPSVSATAQLQQQ 523 +A R + GC R+PG P PR S + P L++ G R +S PS++A Q Sbjct: 46 SAERASPHGC--RHPG-PGPRWCSDVPHPP----LKIPGG-RGDSQRDPSLAAAPLYSDQ 97 Query: 524 VVNKILERKDKHPVKI-DFKIYLTENTVIRWEAVVHNNMMYSACPGSAVP 670 ++ E ++ + L++ + W AV+ N +Y P A+P Sbjct: 98 RLSVTEELTPSGQTRVLHVRSRLSDARQVSWRAVLSANRLYVELPAGALP 147 >AF098300-1|AAD23379.1| 1045|Homo sapiens topoisomerase I-binding RS protein protein. Length = 1045 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 598 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 657 >AB045733-1|BAB03715.1| 980|Homo sapiens RING-finger protein protein. Length = 980 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 533 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 592 >AB045732-1|BAB03714.1| 1045|Homo sapiens RING-finger protein protein. Length = 1045 Score = 29.9 bits (64), Expect = 8.9 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -1 Query: 351 RAVQSREQGHQDH-HRGPAPRHSEKHSASEADRVSVCCRERSETPRHRNKPSRPVWSRRS 175 R+ SR Q H + H +K S+ R R R + R++ WSRRS Sbjct: 598 RSSDSRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRS 657 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,590,053 Number of Sequences: 237096 Number of extensions: 2033117 Number of successful extensions: 7475 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 7080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7467 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -