BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060492.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 2.3 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 1.3 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = +2 Query: 221 FNFAVVDNNRQRXKSHXIWXSVSEQXF 301 + FAV+D++ K H W + + + Sbjct: 2355 YGFAVLDSSSMTLKPHDSWADIDNEFY 2381 Score = 21.0 bits (42), Expect = 9.4 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 221 FNFAVVDNNRQRXKSHXIWXSVSEQXF 301 + FAV+D K+H W Q + Sbjct: 1432 YGFAVLDFENLIVKAHDSWADFDNQFY 1458 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 9 GNDMAPTQGLQRALKQKEYIKIIELAVKSPNNRVYLLNL 125 G D +P LQRA K Y + A K P + + L+ + Sbjct: 114 GGDTSPNSALQRARADKTYRRSYTHA-KPPYSYISLITM 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,057 Number of Sequences: 336 Number of extensions: 2995 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -