BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060492.seq (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 27 3.3 SPAC4H3.03c |||glucan 1,4-alpha-glucosidase |Schizosaccharomyces... 26 4.4 SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces p... 26 4.4 SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosa... 25 7.7 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 26.6 bits (56), Expect = 3.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 94 LPTIVSICSICKMTRFXSAXRANVTDAPILFTC 192 LP ++ +CS+ T+ ++ ANVT A IL C Sbjct: 368 LPNLLKVCSV---TKKLASQAANVTFAAILVNC 397 >SPAC4H3.03c |||glucan 1,4-alpha-glucosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 588 TIWHVRGQIRRFPYSSHRLCSAAXQVL 508 +IW VRGQ R F YS L A + L Sbjct: 430 SIWEVRGQERNFLYSKIMLWVALDRAL 456 >SPBC19C7.09c |uve1|uvde|endonuclease Uve1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 599 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 554 KRLICPRTCQIVSRSSDGXHFVXALREXRVAKNLKI 661 +R+ C RTC+I + DG V L V +K+ Sbjct: 264 ERVFCSRTCRITTIQRDGLESVKQLGTQNVLDLIKL 299 >SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosaccharomyces pombe|chr 1|||Manual Length = 990 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 24 PTQGLQRALKQKEYIKIIELAVKSPNNRVYLLNLQDDTF 140 P++GL++ + +Y+K+I K V ++ + TF Sbjct: 513 PSRGLRKRFRHGDYVKVIAGKYKDDTGMVVRISKDEVTF 551 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,599,467 Number of Sequences: 5004 Number of extensions: 47332 Number of successful extensions: 114 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -