BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060491.seq (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosacch... 27 1.9 SPAPB24D3.01 ||SPAPB2C8.02|transcription factor |Schizosaccharom... 26 4.4 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 26 4.4 SPBC1539.09c |trp1||anthranilate synthase component II|Schizosac... 26 4.4 SPAC6G9.13c |bqt1|mug23, rec26|bouquet formation protein Bqt1|Sc... 26 5.8 SPCC18B5.06 |erf1|sup45|translation release factor eRF1|Schizosa... 26 5.8 SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Sch... 25 7.7 SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosa... 25 7.7 >SPAC977.10 |sod2||CPA1 sodium ion/proton antiporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 468 Score = 27.5 bits (58), Expect = 1.9 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = -2 Query: 209 IQFVAKHVNKIGASVTFARYALPKRVILQIEQIDTIVGRFDGQFNYF 69 + F+ KH K + Y+LP + L I TI+G D ++F Sbjct: 227 LSFILKHAQKYRLIDAISYYSLPLAIPLLCSGIGTIIGVDDLLMSFF 273 >SPAPB24D3.01 ||SPAPB2C8.02|transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 594 Score = 26.2 bits (55), Expect = 4.4 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 395 FAAPTTRGYCNFWIFLPCP 339 F P + C W+FL CP Sbjct: 493 FIIPIAKNVCYLWVFLYCP 511 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 94 LPTIVSICSICKMTRFGSAYRANVTDAPILFTC 192 LP ++ +CS+ K ++ ANVT A IL C Sbjct: 368 LPNLLKVCSVTKKL---ASQAANVTFAAILVNC 397 >SPBC1539.09c |trp1||anthranilate synthase component II|Schizosaccharomyces pombe|chr 2|||Manual Length = 759 Score = 26.2 bits (55), Expect = 4.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 201 KLDWKIISILPLSITIANGL 260 K+DW+ S +P+S +A GL Sbjct: 696 KVDWEAASFIPVSYVLAGGL 715 >SPAC6G9.13c |bqt1|mug23, rec26|bouquet formation protein Bqt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 132 Score = 25.8 bits (54), Expect = 5.8 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 576 ARLCQDQRRAHLYCLREXRVQELKLIAHSIPWS 674 A LCQ Q + L + E KL + +PWS Sbjct: 68 ALLCQGQNKESLIHMEEDASTNFKLRYYVLPWS 100 >SPCC18B5.06 |erf1|sup45|translation release factor eRF1|Schizosaccharomyces pombe|chr 3|||Manual Length = 390 Score = 25.8 bits (54), Expect = 5.8 Identities = 22/107 (20%), Positives = 48/107 (44%), Gaps = 4/107 (3%) Frame = +2 Query: 107 CLFAQFAR*HVLEAHIARMLRTRRFYSRVSQQIGLENYFNFAVVDNNRQRFKSHLIWSLV 286 CL + +L I +++ +R + Q GL+ +++ N + L ++ Sbjct: 150 CLITDYMT--ILRQRIDQVIPRKRRGDSSAYQKGLDKFYDSVFQSINSEFDFDKLKVVIL 207 Query: 287 SEQKFLTQ---DFILAFGDLLDMEEISKNYNN-LVLSVQQKYAHKLN 415 + F+ + D+I + LD+++I K+ N ++L + H LN Sbjct: 208 ASPGFVARGLYDYIFSMAVKLDLKQIVKSKNKFVILHSSTGHIHSLN 254 >SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 185 NKIGASVTFARYALPKRVILQIEQID 108 +K+GA+ T A + PK +ILQ + D Sbjct: 505 SKLGATTTTAMKSFPKVLILQANRFD 530 >SPAC23C4.19 |spt5||transcription elongation factor Spt5|Schizosaccharomyces pombe|chr 1|||Manual Length = 990 Score = 25.4 bits (53), Expect = 7.7 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 24 PTQGLQRALKQKEYIKIIELAVKSPNNRVYLLNLQDDTF 140 P++GL++ + +Y+K+I K V ++ + TF Sbjct: 513 PSRGLRKRFRHGDYVKVIAGKYKDDTGMVVRISKDEVTF 551 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,977,667 Number of Sequences: 5004 Number of extensions: 62859 Number of successful extensions: 177 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -