BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060491.seq (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0410 + 18701258-18701327,18701398-18701630,18701782-187026... 32 0.37 11_06_0520 + 24539403-24539603,24539919-24540325,24541002-245411... 29 3.4 10_01_0140 - 1674305-1674586,1674683-1674838,1675676-1676622,167... 29 3.4 04_04_0075 - 22542486-22542882,22543181-22543362,22543452-225436... 29 3.4 01_06_0767 + 31823659-31823734,31823859-31823979,31824078-318241... 29 4.5 01_02_0095 - 11076493-11077644,11077845-11077918,11078155-11078320 29 4.5 >12_02_0410 + 18701258-18701327,18701398-18701630,18701782-18702639, 18703006-18703865,18704285-18704395,18704486-18704567, 18704643-18704735,18704795-18704989 Length = 833 Score = 32.3 bits (70), Expect = 0.37 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +1 Query: 82 WPS-NLPTIVSICS--ICKMTRFGSAYRANVTDAP-ILFT 189 WP P++ ++CS +CKM R YR TD P IL++ Sbjct: 737 WPCYKRPSLTNLCSYYVCKMLRVNGRYRTEFTDLPSILYS 776 >11_06_0520 + 24539403-24539603,24539919-24540325,24541002-24541187, 24541550-24541742,24541945-24542021,24542400-24542550, 24543229-24543462,24543577-24543591 Length = 487 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 565 SAYMQDCVKISDALICIAYVXAACKN 642 S Y+ DC +ISD +C Y+ CKN Sbjct: 295 SLYLVDCSRISDDALC--YIAQGCKN 318 >10_01_0140 - 1674305-1674586,1674683-1674838,1675676-1676622, 1678976-1679054,1679168-1679207,1679580-1679767, 1679869-1680024,1680752-1681713,1681866-1681914 Length = 952 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 336 KSPNASIKSCVKNFC-SDTNDQIKCDLNRW 250 + PNASI+S FC SD D + NRW Sbjct: 145 RDPNASIRSFFLRFCRSDGGDDGSAEGNRW 174 >04_04_0075 - 22542486-22542882,22543181-22543362,22543452-22543637, 22543959-22544057,22546198-22546314,22547739-22547855 Length = 365 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Frame = -1 Query: 393 CCTDNTRLL*FLDISSMSNKSPNASIKSCVKNFCS----DTNDQIKCD 262 C T R F D+S + N+SI SC+KNFCS + D+ CD Sbjct: 185 CETVTARDETFFDLSV--DIEQNSSITSCLKNFCSTETLNAEDKFFCD 230 >01_06_0767 + 31823659-31823734,31823859-31823979,31824078-31824189, 31824278-31824691,31824795-31824898,31825017-31825136, 31825344-31825467,31826567-31826680,31826789-31826980, 31827328-31827424,31827505-31827653,31828729-31829013 Length = 635 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = -1 Query: 327 NASIKSCVKNFCSDTNDQIKCDLNRWRLLSTTAKL 223 NAS+K+ + C + +++I+ DLN+ + ++ T L Sbjct: 355 NASVKTWLDRLCEELSERIQSDLNQNKRIAQTLTL 389 >01_02_0095 - 11076493-11077644,11077845-11077918,11078155-11078320 Length = 463 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -2 Query: 227 N*NNFPIQFVAKHVNKIGASVTFARYALPKRVILQIEQIDTIVGRFDG 84 N ++ +Q + VN G S+T+ARYAL ++ + I+ F G Sbjct: 73 NFSHMEVQLMDWMVNTKGMSMTYARYALHLELLYSVYGIEAAEEYFSG 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,528,495 Number of Sequences: 37544 Number of extensions: 370303 Number of successful extensions: 833 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -