BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060491.seq (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g45230.1 68414.m05193 defective chloroplasts and leaves prote... 32 0.41 At1g34160.1 68414.m04237 pentatricopeptide (PPR) repeat-containi... 29 2.2 At5g35917.1 68418.m04317 cytochrome P450, putative similar to Cy... 28 6.6 At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain... 28 6.6 At3g23260.1 68416.m02932 F-box family protein contains Pfam PF00... 28 6.6 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 27 8.8 At2g16750.1 68415.m01921 protein kinase family protein contains ... 27 8.8 >At1g45230.1 68414.m05193 defective chloroplasts and leaves protein-related / DCL protein-related similar to defective chloroplasts and leaves (DCL) protein SP:Q42463 from [Lycopersicon esculentum] Length = 219 Score = 31.9 bits (69), Expect = 0.41 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = -3 Query: 403 CVFLLHRQHEVIVIFGYFFHVQQVAKREYKILRQKFLLRHQR 278 C+F++ + EV V F Y+ ++ + K++Y + F+LRH R Sbjct: 173 CMFIVRKDGEV-VDFSYWKCIKGLIKKKYPLYADSFILRHFR 213 >At1g34160.1 68414.m04237 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 558 Score = 29.5 bits (63), Expect = 2.2 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 321 SIKSCVKNFCSDTNDQIKCDLNR 253 ++K+C + CS DQ+ C +NR Sbjct: 115 TLKACARALCSSAMDQLHCQINR 137 >At5g35917.1 68418.m04317 cytochrome P450, putative similar to Cytochrome P450 79A2 (SP:Q9FLC8) {Arabidopsis thaliana} Length = 490 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 308 QDFILAFGDL-LDMEEISKNYNNLVLSVQQKYAHKLNWKRIVASHILLKEWFK 463 QD + A L + E S+ Y L ++VQ + +R+VASH+ K+ FK Sbjct: 106 QDSVFAIRPLTMGTEYCSRGY--LTIAVQSQGEQWKKMRRVVASHVTSKKSFK 156 >At5g20360.1 68418.m02422 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein contains Pfam profiles PF00564: PB1 domain, PF00515: TPR Domain Length = 809 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 374 LVLSVQQKYAHKLNWKRIVASHILLKEWFKEPIKQY 481 L L +QQ +L+W ++ SH+ LK W + Q+ Sbjct: 602 LALGLQQFEEARLSWYYVLVSHLDLKTWPYADVVQF 637 >At3g23260.1 68416.m02932 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 362 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +2 Query: 197 QQIGLENYFNFAVVDNNRQRFKSHLIWSLVSEQKFLTQDFILAFGDLLDMEE---ISKNY 367 +Q+ L Y+N++ + + + + S+VS KFLT I D+ D + + Sbjct: 252 EQLCLFGYYNWSTTSEDLNVWVTTSLGSVVSWSKFLTIQIIKPRVDMFDYGMSFLVDEQN 311 Query: 368 NNLVLSVQQKYAH 406 +LV + QK H Sbjct: 312 KSLVCWISQKVLH 324 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 357 DISSMSNKSPNASIKSCVK 301 ++ MSNKSP ++KSC K Sbjct: 111 NVGDMSNKSPEVTLKSCRK 129 >At2g16750.1 68415.m01921 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 617 Score = 27.5 bits (58), Expect = 8.8 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 354 ISSMSNKSPNASIKSCVKNFCSDTNDQIKCDLNRW 250 + S+ + P+ ++C ++FC I D+NRW Sbjct: 230 VMSLPERFPHHPNQTCQQSFCDKQLKDILKDINRW 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,300,589 Number of Sequences: 28952 Number of extensions: 314616 Number of successful extensions: 784 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -