BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060490.seq (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19820.1 68418.m02355 PBS lyase HEAT-like repeat-containing p... 58 5e-09 At4g27640.1 68417.m03973 importin beta-2 subunit family protein ... 41 9e-04 At2g47230.1 68415.m05898 agenet domain-containing protein contai... 36 0.019 At5g57020.1 68418.m07117 myristoyl-CoA:protein N-myristoyltransf... 30 1.7 At5g16000.1 68418.m01871 leucine-rich repeat family protein / pr... 28 5.0 At4g21030.1 68417.m03042 Dof-type zinc finger domain-containing ... 27 8.8 >At5g19820.1 68418.m02355 PBS lyase HEAT-like repeat-containing protein contains Pfam profile: PF03130 PBS lyase HEAT-like repeat Length = 1116 Score = 58.0 bits (134), Expect = 5e-09 Identities = 35/145 (24%), Positives = 71/145 (48%), Gaps = 6/145 (4%) Frame = +2 Query: 101 NRNKSSAPSEFNSKCRHCRRCASNG-GRAVTKII*CRIL*-----VLPEIAI*AADSVRE 262 N K S P + K H + + + GRA+ ++ ++L + P +++ S++ Sbjct: 47 NLAKQSNPDTLSLKLAHLLQLSPHPEGRAMAAVLLRKLLTRDDAYLWPRLSLSTQSSLKS 106 Query: 263 QLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPEFLQFXFTCASAQDPNIKEAG 442 +L +Q + ++ + +K+CD VSELA + ++G WPE L F F C ++ P ++E+ Sbjct: 107 SMLYCIQHEEAKSISKKICDTVSELASGILPENG---WPELLPFVFQCVTSVTPKLQESA 163 Query: 443 IRMFTSVPGVFGNRQTXNLDVIKAV 517 + + G T ++ + V Sbjct: 164 FLILAQLSQYVGETLTPHIKELHGV 188 >At4g27640.1 68417.m03973 importin beta-2 subunit family protein low similarity to importin 4 GI:18700635 from [Homo sapiens] Length = 1048 Score = 40.7 bits (91), Expect = 9e-04 Identities = 20/76 (26%), Positives = 42/76 (55%) Frame = +2 Query: 254 VREQLLLTLQMDLSQYLRRKVCDVVSELARNHIDDDGNNQWPEFLQFXFTCASAQDPNIK 433 V++ L+ ++ ++ S +RR +VVS +A+ + +WP+ L F F C+ + + + Sbjct: 79 VKQSLIESITVENSPPVRRASANVVSVVAKYAVPA---GEWPDLLTFLFQCSQSAQEDHR 135 Query: 434 EAGIRMFTSVPGVFGN 481 E + +F+S+ GN Sbjct: 136 EVALILFSSLTETIGN 151 Score = 37.9 bits (84), Expect = 0.006 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 30 LLNTLLSTDNDIRSQAEDAYNNIPTETKVV-HLVNSIQNADIAEDVRQTAAVLLRR 194 LL L DND R QAED + + +VV LV ++ A +VRQ AAVLLR+ Sbjct: 8 LLIQFLMPDNDARRQAEDQIKRLAKDPQVVPALVQHLRTAK-TPNVRQLAAVLLRK 62 >At2g47230.1 68415.m05898 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 701 Score = 36.3 bits (80), Expect = 0.019 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +3 Query: 33 LNTLLSTDNDIRSQAEDAYNNIPTETKVVHLVNSIQNADIAEDVRQTAA 179 +N S ND+ Q A+ N+PTET + H + NA IA DV + A Sbjct: 459 INDTSSICNDVDDQPLAAWINLPTETSIDHSPIVVNNAAIATDVEERQA 507 >At5g57020.1 68418.m07117 myristoyl-CoA:protein N-myristoyltransferase 1 (NMT1) identical to N-myristoyltransferase 1 (NMT1) [Arabidopsis thaliana] GI:7339834 Length = 434 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 9 DQAQFYQLLNTLLSTDNDIRSQAEDAYNNIPTETKVVHLVN 131 D FY L +T+L N +A +Y N+ T+T + L+N Sbjct: 333 DFCSFYTLPSTILGNPNYTTLKAAYSYYNVATQTSFLQLMN 373 >At5g16000.1 68418.m01871 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 638 Score = 28.3 bits (60), Expect = 5.0 Identities = 8/31 (25%), Positives = 20/31 (64%) Frame = -2 Query: 517 NSLYHIQVXSLTISKYTWYRRKHSNTSFFDV 425 +S+ + + + + + W+R++H+ +FFDV Sbjct: 253 SSVGTVSLIFIAVGLFLWWRQRHNQNTFFDV 283 >At4g21030.1 68417.m03042 Dof-type zinc finger domain-containing protein prolamin box binding factor, Zea mays, PID:g2393775 Length = 194 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 101 NRNKSSAPSEFNSKCRHCRRCASNGG 178 N NK S P KC++C RC ++GG Sbjct: 37 NNNKKSQP---RYKCKNCCRCWTHGG 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,230,596 Number of Sequences: 28952 Number of extensions: 239699 Number of successful extensions: 543 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -