BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060485.seq (686 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.1 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 8.3 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 126 YKDKSKPTDIRLSNINAAKAVADAIRTSLGPR 221 Y+ KP + ++ INA K + AIR +GP+ Sbjct: 493 YRLNHKPFNFHIT-INADKPMKAAIRIFIGPK 523 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 126 YKDKSKPTDIRLSNINAAKAVADAIRTSLGPR 221 Y+ KP + ++ INA K + AIR +GP+ Sbjct: 493 YRLNHKPFNFHIT-INADKPMKAAIRIFIGPK 523 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 8.3 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 550 AAATSLNSKVVSQHSTILGTHCSASNSSSN 639 AAA +L SK S LGT S S+++S+ Sbjct: 161 AAAAALLSKRRSVSECSLGTASSTSSTASS 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,270 Number of Sequences: 438 Number of extensions: 3770 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -