BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060483.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 28 0.082 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 25 0.76 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 23 3.1 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.1 DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 21 9.4 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 27.9 bits (59), Expect = 0.082 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 52 YXIQEYKRVVSKVYKNQTW*TCXSNNLLQKLRPCAKMK 165 Y Y VV+ YK +TW LL+ L CAK+K Sbjct: 76 YCFNYYVIVVTTFYKRRTW-----TRLLKNLESCAKIK 108 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 24.6 bits (51), Expect = 0.76 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 554 SLAFFARWNCCVVA*NTISIXRPFFY 477 ++ FF+ W C +V N I F+Y Sbjct: 42 AVTFFSAWICALVNYNVSEISENFYY 67 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 22.6 bits (46), Expect = 3.1 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +2 Query: 464 TEKMGKKMXXRSRSCFKRQRSNSSEQKKPDCGGYXRKF 577 T+K G K R KR N E+K G Y +K+ Sbjct: 81 TQKNGSKKIMRHLIDHKRDWWNELEEKYDKEGEYRKKY 118 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 515 RQRSNSSEQKKPDC 556 +Q SN S KPDC Sbjct: 84 QQNSNYSSNSKPDC 97 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 441 ILCSFLITLKRWVKKWXXDRDRVSSD 518 ILC+FL+ + K+ D V D Sbjct: 8 ILCAFLVAVSAAENKYTNKYDNVDVD 33 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,015 Number of Sequences: 336 Number of extensions: 2438 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -