BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060483.seq (684 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1142.06 |get3||GET complex ATPase subunit Get3 |Schizosaccha... 26 4.4 SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharom... 25 7.7 >SPAC1142.06 |get3||GET complex ATPase subunit Get3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 329 Score = 26.2 bits (55), Expect = 4.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 7 LHPQTNCPGCWALKKYXIQEYKRVVSKVYKN 99 L P T CP C A +K Q+Y + ++Y++ Sbjct: 262 LDPNTTCPQCMARRKMQ-QKYLAQIEELYED 291 >SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharomyces pombe|chr 3|||Manual Length = 1690 Score = 25.4 bits (53), Expect = 7.7 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +1 Query: 25 CPGCWAL--KKYXIQEYKRVVSKVYKNQTW*TC 117 C G AL K Y +EY V S VYK Q TC Sbjct: 781 CDGLVALVPKAYISEEYVPVPSAVYKPQQSVTC 813 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,301,673 Number of Sequences: 5004 Number of extensions: 38555 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -