BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060483.seq (684 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0036 + 7599646-7599950,7600106-7600145,7600403-7600437,760... 28 6.0 06_03_0793 + 24662506-24663512,24664470-24664787,24664996-246653... 28 7.9 >11_02_0036 + 7599646-7599950,7600106-7600145,7600403-7600437, 7600789-7601189,7601281-7601361,7601451-7601536 Length = 315 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 478 THLFSVIKNEHKICQFGRXFHQIP 407 TH F +K E+ IC F R IP Sbjct: 198 THSFDAMKKEYYICGFARSIESIP 221 >06_03_0793 + 24662506-24663512,24664470-24664787,24664996-24665323, 24665465-24665887,24665960-24666252,24666332-24666605, 24666856-24667358,24667464-24667785,24667875-24668220, 24668339-24668997,24669524-24669625,24669656-24670052, 24670155-24670270,24670360-24670386 Length = 1704 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 607 RNXALSF-NAAKFAXVTTAVWLFLLAGIAALSLETRSRSXXHFFTHLFSVIKNEHKI 440 RN +S NA + ++W+ LLAG+A L+ ++RS LF ++K+ ++ Sbjct: 1246 RNLGMSDGNATVDKDDSISLWIPLLAGLAKLTSDSRSTIKRSAVGVLFDILKDHGQL 1302 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,325,004 Number of Sequences: 37544 Number of extensions: 230689 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -