BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060483.seq (684 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50110-3|CAA90445.2| 459|Caenorhabditis elegans Hypothetical pr... 28 5.4 U42436-4|AAF99896.2| 297|Caenorhabditis elegans Hypothetical pr... 28 7.1 >Z50110-3|CAA90445.2| 459|Caenorhabditis elegans Hypothetical protein F18H3.4 protein. Length = 459 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 96 KSNMVNMXEQQSSTETAAVCKNEKLLNKLEXSSYNKSNMDQ 218 K N+ EQ TE A+ +N+KLL L + ++ MDQ Sbjct: 121 KRNLSARDEQALVTEIDALKRNKKLLESLAEITSHRKGMDQ 161 >U42436-4|AAF99896.2| 297|Caenorhabditis elegans Hypothetical protein C49H3.9 protein. Length = 297 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 13 PQTNCPGCWALKKYXIQEYKRVVSKVYKNQTW*TC 117 PQ C +L KY E + K YK TW C Sbjct: 35 PQKRCKKAASLHKYRDMETYHKIIKTYKAPTWYGC 69 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,874,031 Number of Sequences: 27780 Number of extensions: 224166 Number of successful extensions: 481 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -