BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060483.seq (684 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g22275.1 68414.m02784 expressed protein 28 5.0 At1g11090.1 68414.m01270 hydrolase, alpha/beta fold family prote... 27 8.8 >At1g22275.1 68414.m02784 expressed protein Length = 856 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 4/57 (7%) Frame = +3 Query: 102 NMVNMXEQQSSTETAAVCKNEKLLNKLEXSSYNKSNMDQL----IAIVNXLEKKNLT 260 ++V++ E+ +T +++L KL S +D+L IA + L+KKNLT Sbjct: 250 HLVSIQEKLEKEKTNVQLSSDELFEKLVRSEQEVKKLDELVHYLIAELTELDKKNLT 306 >At1g11090.1 68414.m01270 hydrolase, alpha/beta fold family protein similar to monoglyceride lipase from [Homo sapiens] GI:14594904, [Mus musculus] GI:2632162; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 324 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 390 LVARPCGIW*KXRPNWQILCSFLITLKRWVKKW 488 LVA C I K RP W + FLI + R++ W Sbjct: 161 LVAPMCKISDKVRPKWPV-DQFLIMISRFLPTW 192 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,935,994 Number of Sequences: 28952 Number of extensions: 198448 Number of successful extensions: 431 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -