BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060476.seq (587 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 27 0.16 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 4.4 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 4.4 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 4.4 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 7.7 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.7 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 26.6 bits (56), Expect = 0.16 Identities = 15/64 (23%), Positives = 30/64 (46%) Frame = +2 Query: 59 DYHENGSLHDYLQTVVLDSNSLMTMTYSIVSGLAHLHMDIYGTKGKXAIAHRDIKSKNIL 238 D+H +D+ ++ L+++ + G+ HL K + HRD+ ++N+L Sbjct: 577 DFHNMSFENDF----IIQPKHLLSIARQVALGMEHL--------AKTRVVHRDLAARNVL 624 Query: 239 VKRN 250 V N Sbjct: 625 VCEN 628 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 169 HGHIRHEGQAGDRAPRHQEQEH 234 H IR DR PRH +EH Sbjct: 245 HIPIRQCDDHRDRPPRHFHEEH 266 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 262 WRTPVALHEDVLALDVAVRDR 200 + TP +LH + A+D+ DR Sbjct: 45 YHTPESLHYEGRAVDITTSDR 65 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 4.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 Query: 281 PCGTSPSGTRWTSR 322 PCGTS + WT + Sbjct: 227 PCGTSGNPLEWTGQ 240 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 489 GSTNCALSXLRSADTLXHTSRAST 418 GSTN +AD+ HT AST Sbjct: 46 GSTNGDGGARSNADSTSHTDGAST 69 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 Query: 489 GSTNCALSXLRSADTLXHTSRAST 418 GSTN +AD+ HT AST Sbjct: 202 GSTNGDGGARSNADSTSHTDGAST 225 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,648 Number of Sequences: 336 Number of extensions: 1542 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -