BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060475.seq (646 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 23 2.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 3.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 3.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 3.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 3.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 3.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 3.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 3.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 3.8 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 22 5.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 6.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 6.6 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 8.7 AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 21 8.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 8.7 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.7 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 21 8.7 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 21 8.7 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 8.7 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 23.0 bits (47), Expect = 2.2 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = -2 Query: 360 LLLFRRQVENCFLVGGMRLQYVSLYVEVLPADQRLADPSSRARSVSSTPKQ 208 LL+F +Q+ CF V +RL+ L +R+ + ++ SV KQ Sbjct: 181 LLIFVQQIPFCFFVRVIRLKIEDLNGAFRAGLERVQNGENQWISVMKVNKQ 231 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.2 bits (45), Expect = 3.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W LW S+ W Sbjct: 465 WIWLLWLLSQTW 476 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 162 ASQNLSSPASSTSSTSSTEK 181 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 162 ASQNLSSPASSTSSTSSTEK 181 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 162 ASQNLSSPASSTSSTSSTEK 181 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 162 ASQNLSSPASSTSSTSSTEK 181 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 118 ASQNLSSPASSTSSTSSTEK 137 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 162 ASQNLSSPASSTSSTSSTEK 181 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 270 ADQRLADPSSRARSVSSTPK 211 A Q L+ P+S S SST K Sbjct: 162 ASQNLSSPASSTSSTSSTEK 181 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 216 VSMIHCALSNSDPRDVDLLG 275 + ++ LSN + DVDL+G Sbjct: 144 IDFLYHVLSNENALDVDLIG 163 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.6 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W +W S+ W Sbjct: 219 WIWLVWLLSQAW 230 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.6 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W +W S+ W Sbjct: 452 WIWLVWLLSQAW 463 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 6.6 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 Query: 395 WSWSLWSASRCW 430 W W +W S+ W Sbjct: 452 WIWLVWLLSQAW 463 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 93 PFSPPYDTSTSFMILAWRRGSNISDWDSLV 4 P P + L R GSN + W+SL+ Sbjct: 80 PVIDPAKDPAIYSNLLPRPGSNDNSWESLI 109 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 293 LCMSRFSQQINVSR 252 LC+ RFSQ N++R Sbjct: 110 LCLLRFSQSGNLNR 123 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 293 LCMSRFSQQINVSR 252 LC+ RFSQ N++R Sbjct: 366 LCLLRFSQSGNLNR 379 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 8.7 Identities = 10/43 (23%), Positives = 15/43 (34%) Frame = -1 Query: 625 CLVLVCSKASMS*DCRFPVVSCIDGSHFVRRNRHPSKPRRTAS 497 C + C M +C P V C + + KP T + Sbjct: 243 CRLKKCLSVGMRPECVVPEVQCAVKRKEKKAQKEKDKPNSTTN 285 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 133 LQGFRSQLYSLIETV 89 LQ ++Q+YSL ETV Sbjct: 178 LQVIKAQIYSLRETV 192 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 133 LQGFRSQLYSLIETV 89 LQ ++Q+YSL ETV Sbjct: 178 LQVIKAQIYSLRETV 192 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 133 LQGFRSQLYSLIETV 89 LQ ++Q+YSL ETV Sbjct: 498 LQVIKAQIYSLRETV 512 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,722 Number of Sequences: 336 Number of extensions: 3313 Number of successful extensions: 26 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -