BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060473.seq (428 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 30 0.040 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 2.0 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 2.6 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 22 8.0 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 22 8.0 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 29.9 bits (64), Expect = 0.040 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 3/30 (10%) Frame = -3 Query: 114 CGLS*ILCPPIAVHDGGSRVT---RRSYSS 34 CG S I PP A+H GGSR T +R+YS+ Sbjct: 874 CG-SGIASPPAAIHGGGSRTTTVLKRTYSN 902 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 24.2 bits (50), Expect = 2.0 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Frame = -1 Query: 266 RSLSSVL-NELYTD-AF-ADGRVGLLSFYTNFLEDDALCVRCTTERVS-LPF 123 RS+++++ NE + D A+ AD R LLS +FLED + ER LPF Sbjct: 301 RSIATLMSNEHFHDIAYTADDREELLSAIDDFLEDSIVLPPSKWERQGLLPF 352 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 2.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 83 MGGQRIQESPHGYEMEG*PFRWC 151 MG I SP G +M F WC Sbjct: 83 MGVMPIMRSPKGVDMPRTTFTWC 105 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +3 Query: 168 IVLEK--VGVEAKQPNSAIRKC 227 ++ EK VG+EA + N I+KC Sbjct: 113 VIREKLTVGIEAGKVNELIKKC 134 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = +3 Query: 168 IVLEK--VGVEAKQPNSAIRKC 227 ++ EK VG+EA + N I+KC Sbjct: 144 VIREKLTVGIEAGKVNELIKKC 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.316 0.132 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 463,454 Number of Sequences: 2352 Number of extensions: 8729 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -