BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060473.seq (428 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribo... 111 3e-25 At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) simi... 102 1e-22 At1g28470.1 68414.m03501 no apical meristem (NAM) family protein... 29 1.8 At4g34138.1 68417.m04844 UDP-glucoronosyl/UDP-glucosyl transfera... 28 3.1 At1g32960.1 68414.m04059 subtilase family protein contains simil... 28 3.1 At1g32940.1 68414.m04057 subtilase family protein contains simil... 28 3.1 At5g60490.1 68418.m07586 fasciclin-like arabinogalactan-protein ... 27 4.1 At3g52200.1 68416.m05733 dihydrolipoamide S-acetyltransferase, p... 27 5.4 At4g10550.1 68417.m01727 subtilase family protein contains simil... 27 7.1 At1g07150.1 68414.m00761 protein kinase family protein contains ... 26 9.4 >At5g02960.1 68418.m00239 40S ribosomal protein S23 (RPS23B) ribosomal protein S23, Fragaria x ananassa, PIR:S56673 Length = 142 Score = 111 bits (266), Expect = 3e-25 Identities = 48/64 (75%), Positives = 57/64 (89%) Frame = +3 Query: 69 RREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIK 248 R QRWADK++KK+H+G +WK PF G+SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIK Sbjct: 17 RINQRWADKQYKKSHLGNEWK-KPFAGSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIK 75 Query: 249 NGRK 260 NG+K Sbjct: 76 NGKK 79 Score = 62.9 bits (146), Expect = 9e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 322 VAGFGRXGHAVGDIPGVRYXVVKVANVSLLALYKE 426 +AGFGR GHAVGDIPGVR+ VVKV+ VSLLAL+KE Sbjct: 101 IAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKE 135 Score = 43.6 bits (98), Expect = 6e-05 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +2 Query: 254 KKVTAFVPRDGCLNHIEENDE 316 KK+ AFVP DGCLN+IEENDE Sbjct: 78 KKIAAFVPNDGCLNYIEENDE 98 >At3g09680.1 68416.m01147 40S ribosomal protein S23 (RPS23A) similar to 40S ribosomal protein S23 (S12) GB:P46297 from [Fragaria x ananassa] Length = 142 Score = 102 bits (244), Expect = 1e-22 Identities = 46/64 (71%), Positives = 54/64 (84%) Frame = +3 Query: 69 RREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIK 248 R QRWADK +KK++ G +WK PF +SHAKGIVLEK+G+EAKQPNSAIRKC RVQLIK Sbjct: 17 RITQRWADKHYKKSNRGNEWK-KPFACSSHAKGIVLEKIGIEAKQPNSAIRKCARVQLIK 75 Query: 249 NGRK 260 NG+K Sbjct: 76 NGKK 79 Score = 62.9 bits (146), Expect = 9e-11 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 322 VAGFGRXGHAVGDIPGVRYXVVKVANVSLLALYKE 426 +AGFGR GHAVGDIPGVR+ VVKV+ VSLLAL+KE Sbjct: 101 IAGFGRKGHAVGDIPGVRFKVVKVSGVSLLALFKE 135 Score = 43.6 bits (98), Expect = 6e-05 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +2 Query: 254 KKVTAFVPRDGCLNHIEENDE 316 KK+ AFVP DGCLN+IEENDE Sbjct: 78 KKIAAFVPNDGCLNYIEENDE 98 >At1g28470.1 68414.m03501 no apical meristem (NAM) family protein contains Pfam PF02365: No apical meristem (NAM) domain; similar to NAM protein GI:6066594 from [Petunia hybrida] Length = 314 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -1 Query: 338 RPNPATSIRRF----LRCGLGNRHGGRMRSLSSVLNELYTDAFADGRVGLLSF 192 +P ++ RF ++ G G HGG+ + V+ EL DG LSF Sbjct: 248 KPKNLVNLNRFSYENIQAGFGYEHGGKSEETTQVIRELVVRE-GDGSCSFLSF 299 >At4g34138.1 68417.m04844 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 488 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 20 KWVNPEEYERRVTREPPS*TAMGGQRIQESPHGYEMEG*PFRWCISRKGHR-PRESW 187 KW++ ++ + + + ++ +++ E G +M G F W ++RKG + +E W Sbjct: 280 KWLDSKKCDSVIYMAFGTMSSFKNEQLIEIAAGLDMSGHDFVWVVNRKGSQVEKEDW 336 >At1g32960.1 68414.m04059 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 [Oryza sativa] Length = 777 Score = 27.9 bits (59), Expect = 3.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 84 WADKEFKKAHMGTKWKANPFGGASHAKG 167 W+ F+ A + T W+ +PFG A+G Sbjct: 575 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 602 >At1g32940.1 68414.m04057 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 774 Score = 27.9 bits (59), Expect = 3.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 84 WADKEFKKAHMGTKWKANPFGGASHAKG 167 W+ F+ A + T W+ +PFG A+G Sbjct: 572 WSPAAFRSAIVTTAWRTDPFGEQIFAEG 599 >At5g60490.1 68418.m07586 fasciclin-like arabinogalactan-protein (FLA12) Length = 249 Score = 27.5 bits (58), Expect = 4.1 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = -3 Query: 396 GYFYXXITNSGN---VTDGVTXTTESRH*YS 313 G+F +T SGN +T GVT TT S + YS Sbjct: 138 GHFPLNVTTSGNTVNITSGVTNTTVSGNVYS 168 >At3g52200.1 68416.m05733 dihydrolipoamide S-acetyltransferase, putative similar to dihydrolipoamide acetyltransferase (E2) subunit of PDC [Arabidopsis thaliana] GI:559395; contains Pfam profiles PF00198: 2-oxo acid dehydrogenases acyltransferase (catalytic domain), PF00364: Biotin-requiring enzyme, PF02817: e3 binding domain; supporting cDNA gi|5881964|gb|AF066080.1|AF066080 Length = 637 Score = 27.1 bits (57), Expect = 5.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 129 KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGRK*PH 269 K P +S +K V + PNS IRK + +L+++ +K PH Sbjct: 386 KETPSKSSSTSKPSVTQSDNNYEDFPNSQIRKIIAKRLLESKQKIPH 432 >At4g10550.1 68417.m01727 subtilase family protein contains similarity to subtilisin-like protease AIR3 GI:4218991 from [Arabidopsis thaliana] Length = 778 Score = 26.6 bits (56), Expect = 7.1 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 84 WADKEFKKAHMGTKWKANPFGGASHAKG 167 W+ + A + T WK +PFG A+G Sbjct: 576 WSPAAIRSAIVTTAWKTDPFGEQIFAEG 603 >At1g07150.1 68414.m00761 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 499 Score = 26.2 bits (55), Expect = 9.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 65 VHVLRAVRIPRGLPIWIA 12 +H RA+ PRG P+W+A Sbjct: 175 IHTPRALITPRGSPLWMA 192 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.132 0.379 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,655,378 Number of Sequences: 28952 Number of extensions: 197616 Number of successful extensions: 436 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -