BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060470.seq (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 42 1e-05 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 42 1e-05 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 42 1e-05 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 42.3 bits (95), Expect = 1e-05 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAP 411 +S ++ TAV P++ VK LQV A ++YK +V+ F +E+G+ +G Sbjct: 19 ISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLA 78 Query: 412 TFIGYSMQGLCKFGFYEVFKVAYAGMLDDET 504 I Y F F +V+K + G +D T Sbjct: 79 NVIRYFPTQALNFAFKDVYKQVFLGGVDKNT 109 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 42.3 bits (95), Expect = 1e-05 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAP 411 +S ++ TAV P++ VK LQV A ++YK +V+ F +E+G+ +G Sbjct: 19 ISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLA 78 Query: 412 TFIGYSMQGLCKFGFYEVFKVAYAGMLDDET 504 I Y F F +V+K + G +D T Sbjct: 79 NVIRYFPTQALNFAFKDVYKQVFLGGVDKNT 109 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 42.3 bits (95), Expect = 1e-05 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 8/91 (8%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAP 411 +S ++ TAV P++ VK LQV A ++YK +V+ F +E+G+ +G Sbjct: 19 ISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCFVRIPKEQGIGAFWRGNLA 78 Query: 412 TFIGYSMQGLCKFGFYEVFKVAYAGMLDDET 504 I Y F F +V+K + G +D T Sbjct: 79 NVIRYFPTQALNFAFKDVYKQVFLGGVDKNT 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,005 Number of Sequences: 2352 Number of extensions: 13326 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -