BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060470.seq (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 34 0.001 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 34 0.001 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.7 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 6.2 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 33.9 bits (74), Expect = 0.001 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 8/94 (8%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAP 411 ++ ++ T V P++ VK LQV + ++YK +++ F +E+G +G Sbjct: 19 VAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNLA 78 Query: 412 TFIGYSMQGLCKFGFYEVFKVAYAGMLDDETASL 513 I Y F F + +K + G +D T L Sbjct: 79 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFL 112 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 33.9 bits (74), Expect = 0.001 Identities = 23/94 (24%), Positives = 42/94 (44%), Gaps = 8/94 (8%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAP 411 ++ ++ T V P++ VK LQV + ++YK +++ F +E+G +G Sbjct: 19 VAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCFVRIPKEQGFLSYWRGNLA 78 Query: 412 TFIGYSMQGLCKFGFYEVFKVAYAGMLDDETASL 513 I Y F F + +K + G +D T L Sbjct: 79 NVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFL 112 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +3 Query: 270 DPHGRGAPRPGEVSPP 317 DPH A +P +SPP Sbjct: 185 DPHDETAKKPRVLSPP 200 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 111 GPRNGEFRAASSNEEN 64 GPRNG+ + SS EN Sbjct: 210 GPRNGKRKRKSSTIEN 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,644 Number of Sequences: 438 Number of extensions: 4045 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -