BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060470.seq (677 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g14040.1 68418.m01642 mitochondrial phosphate transporter ide... 130 8e-31 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 123 1e-28 At2g17270.1 68415.m01995 mitochondrial substrate carrier family ... 89 3e-18 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 50 2e-06 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 47 1e-05 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 45 5e-05 At2g33820.1 68415.m04149 mitochondrial substrate carrier family ... 45 5e-05 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 44 7e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 43 2e-04 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 43 2e-04 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 42 3e-04 At5g01340.1 68418.m00047 mitochondrial substrate carrier family ... 42 5e-04 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 41 9e-04 At2g47490.1 68415.m05928 mitochondrial substrate carrier family ... 39 0.003 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 39 0.003 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 39 0.003 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 38 0.005 At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein ... 38 0.005 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 38 0.006 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 38 0.008 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 38 0.008 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 38 0.008 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 37 0.011 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 37 0.014 At1g07030.1 68414.m00749 mitochondrial substrate carrier family ... 37 0.014 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 36 0.025 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 36 0.025 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 36 0.025 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 35 0.043 At1g79900.1 68414.m09335 mitochondrial substrate carrier family ... 35 0.043 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 35 0.057 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 35 0.057 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 34 0.075 At5g26200.1 68418.m03118 mitochondrial substrate carrier family ... 34 0.075 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 34 0.075 At5g15640.1 68418.m01830 mitochondrial substrate carrier family ... 33 0.13 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 33 0.17 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 33 0.23 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 32 0.40 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 31 0.93 At2g22500.1 68415.m02669 mitochondrial substrate carrier family ... 30 1.2 At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 30 1.6 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 30 1.6 At2g26360.1 68415.m03164 mitochondrial substrate carrier family ... 30 1.6 At1g72820.1 68414.m08419 mitochondrial substrate carrier family ... 30 1.6 At5g67180.1 68418.m08469 AP2 domain-containing transcription fac... 29 2.1 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 29 2.1 At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (D... 29 2.8 At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transfera... 29 2.8 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 29 3.7 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 29 3.7 At1g79020.1 68414.m09214 transcription factor-related similar to... 29 3.7 At2g14770.2 68415.m01669 Ulp1 protease family protein similar to... 28 4.9 At2g14770.1 68415.m01668 Ulp1 protease family protein similar to... 28 4.9 At5g23940.1 68418.m02811 transferase family protein similar to a... 28 6.5 At4g15010.3 68417.m02307 mitochondrial substrate carrier family ... 28 6.5 At4g15010.2 68417.m02306 mitochondrial substrate carrier family ... 28 6.5 At4g15010.1 68417.m02305 mitochondrial substrate carrier family ... 28 6.5 At4g37590.1 68417.m05320 phototropic-responsive NPH3 family prot... 27 8.6 >At5g14040.1 68418.m01642 mitochondrial phosphate transporter identical to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 375 Score = 130 bits (314), Expect = 8e-31 Identities = 62/138 (44%), Positives = 84/138 (60%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 LSCGLTH V PLDLVKC +Q+D KYK++ +GF + ++E+GV+G +GW PT +GYS Q Sbjct: 87 LSCGLTHMTVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGFFRGWVPTLLGYSAQ 146 Query: 436 GLCKFGFYEVFKVAYAGMLDDETASLTVPSCTWRRLASAELSPDIXPVAHGRPAXVRIQT 615 G CKFGFYE FK Y+ + E + ASAE+ DI + VR+QT Sbjct: 147 GACKFGFYEYFKKTYSDLAGPEYTAKYKTLIYLAGSASAEIIADI-ALCPFEAVKVRVQT 205 Query: 616 MPGFSSNPXGEAWPKXVK 669 PGF+ + +PK +K Sbjct: 206 QPGFARG-MSDGFPKFIK 222 Score = 31.1 bits (67), Expect = 0.70 Identities = 18/65 (27%), Positives = 30/65 (46%) Frame = +2 Query: 62 MFSSLLDAARNSPFRGPLSPAQCQSTVAPVAIEQTGGMAASAAVPTESCEFGSPKYFALC 241 + +L++ N+ F SPA S + I + + AS P + E SP ++A C Sbjct: 24 LLDQVLNSNSNAAFEKSPSPAPRSSPTS--MISRKNFLIASPTEPGKGIEMYSPAFYAAC 81 Query: 242 GVGGV 256 GG+ Sbjct: 82 TFGGI 86 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 123 bits (296), Expect = 1e-28 Identities = 56/138 (40%), Positives = 85/138 (61%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 LSCG+THTA+ PLD++KC +Q+D KYKN+ + FK +++E+G++G +GW+PT +GYS Q Sbjct: 76 LSCGITHTAITPLDVIKCNMQIDPLKYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQ 135 Query: 436 GLCKFGFYEVFKVAYAGMLDDETASLTVPSCTWRRLASAELSPDIXPVAHGRPAXVRIQT 615 G K+G YE K Y+ ++ E A+ ASAE+ D+ + VR+QT Sbjct: 136 GAFKYGLYEYAKKYYSDIVGPEYAAKYKTLIYLAGSASAEIVADV-ALCPMEAVKVRVQT 194 Query: 616 MPGFSSNPXGEAWPKXVK 669 PGF+ + PK +K Sbjct: 195 QPGFARG-LSDGLPKIIK 211 Score = 30.7 bits (66), Expect = 0.93 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 164 TGGMAASAAVPTESCEFGSPKYFALCGVGGV 256 + G + + A P E E SP YFA C V G+ Sbjct: 45 SNGTSFAIATPNEKVEMYSPAYFAACTVAGM 75 >At2g17270.1 68415.m01995 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 88.6 bits (210), Expect = 3e-18 Identities = 46/125 (36%), Positives = 71/125 (56%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 LS G TH A+ PLD++K +QV+ KY ++ +GF +RE G L +GW+ +GY +Q Sbjct: 27 LSAGTTHLAITPLDVLKVNMQVNPVKYNSIPSGFSTLLREHGHSYLWRGWSGKLLGYGVQ 86 Query: 436 GLCKFGFYEVFKVAYAGMLDDETASLTVPSCTWRRLASAELSPDIXPVAHGRPAXVRIQT 615 G C+FG YE FK Y+ +L + + S + ASA++ D+ + VR+QT Sbjct: 87 GGCRFGLYEYFKTLYSDVLPNHNRT----SIYFLSSASAQIFADM-ALCPFEAIKVRVQT 141 Query: 616 MPGFS 630 P F+ Sbjct: 142 QPMFA 146 Score = 30.7 bits (66), Expect = 0.93 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 280 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 411 A+ P + +K R+Q K +++GF R EG+ G +G P Sbjct: 128 ALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFP 171 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 49.6 bits (113), Expect = 2e-06 Identities = 30/91 (32%), Positives = 43/91 (47%), Gaps = 3/91 (3%) Frame = +1 Query: 265 GLTH-TAVVPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 GLT +A PLDLV+ RL Y+ V + F+ REEG+ GL KG T +G Sbjct: 187 GLTAASATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPS 246 Query: 436 GLCKFGFYEVFKVAYAGMLDDETASLTVPSC 528 F YE FK + +++ ++ C Sbjct: 247 LAISFAAYETFKTFWLSHRPNDSNAVVSLGC 277 Score = 33.1 bits (72), Expect = 0.17 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 6/60 (10%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 417 LS ++ TA PLDLV+ R+Q++ A Y + G FK + EG+RGL +G P + Sbjct: 280 LSGIVSSTATFPLDLVRRRMQLEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEY 339 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 46.8 bits (106), Expect = 1e-05 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +1 Query: 265 GLTHTAVV-PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 441 G++ T + PL+LVK RL + YK + + F +REEG L +G AP+ IG Sbjct: 215 GVSQTLLTYPLELVKTRLTIQRGVYKGIFDAFLKIIREEGPTELYRGLAPSLIGVVPYAA 274 Query: 442 CKFGFYEVFKVAYAGMLDDE 501 + Y+ + AY E Sbjct: 275 TNYFAYDSLRKAYRSFSKQE 294 Score = 33.9 bits (74), Expect = 0.099 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 4/76 (5%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEK----YKNVVNGFKVSVREEGVRGLAKGWAPTFIG 423 L+ L+ TA PL++ + +QV A YKN+++ + EG+ G KG P+ + Sbjct: 307 LAGALSSTATFPLEVARKHMQVGAVSGRVVYKNMLHALVTILEHEGILGWYKGLGPSCLK 366 Query: 424 YSMQGLCKFGFYEVFK 471 F YE K Sbjct: 367 LVPAAGISFMCYEACK 382 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 44.8 bits (101), Expect = 5e-05 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +1 Query: 259 SCGLTHTAVV-PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 S G+ T V PL+++K RL V E Y ++ R +G+RG G PT +G Sbjct: 168 SAGIASTLVCHPLEVLKDRLTVSPEIYPSLSLAIPRIFRADGIRGFYAGLGPTLVGMLPY 227 Query: 436 GLCKFGFYEVFKVAY 480 C + Y+ K +Y Sbjct: 228 STCYYFMYDKMKTSY 242 Score = 35.1 bits (77), Expect = 0.043 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 4/73 (5%) Frame = +1 Query: 265 GLTHTAV-VPLDLVKCRLQVDAEKYK---NVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 432 GLT + + PL++ + RL V A K + N+ V++EGV GL +GW + + Sbjct: 264 GLTASTISFPLEVARKRLMVGALKGECPPNMAAAIAEVVKKEGVMGLYRGWGASCLKVMP 323 Query: 433 QGLCKFGFYEVFK 471 + FYE +K Sbjct: 324 SSGITWVFYEAWK 336 >At2g33820.1 68415.m04149 mitochondrial substrate carrier family protein (BAC1) contains Pfam profile: PF00153 mitochondrial carrier protein Length = 311 Score = 44.8 bits (101), Expect = 5e-05 Identities = 32/98 (32%), Positives = 48/98 (48%), Gaps = 8/98 (8%) Frame = +1 Query: 256 LSCGLTHTAVV-PLDLVKCRLQ-----VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 417 + GL AV P D VK +LQ V +YKN ++ ++ EGV+GL +G +F Sbjct: 22 MMAGLATVAVGHPFDTVKVKLQKHNTDVQGLRYKNGLHCASRILQTEGVKGLYRGATSSF 81 Query: 418 IGYSMQGLCKFGFYEVFKVAYAGMLDDE--TASLTVPS 525 +G + + FG Y K+ G L D+ + VPS Sbjct: 82 MGMAFESSLMFGIYSQAKLFLRGTLPDDGPRPEIIVPS 119 Score = 30.7 bits (66), Expect = 0.93 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 8/78 (10%) Frame = +1 Query: 289 PLDLVKCRLQVDA--------EKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 444 P +LVKCR+Q+ +Y + ++ +V+ +GV G+ +G + T + Sbjct: 133 PTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGSATLLRECTGNAV 192 Query: 445 KFGFYEVFKVAYAGMLDD 498 F YE + L+D Sbjct: 193 FFTVYEYLRYHIHSRLED 210 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 44.4 bits (100), Expect = 7e-05 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 6/88 (6%) Frame = +1 Query: 265 GLTHTAVVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 426 GL PLD+VK +LQ D K ++ + F+ V+++G RGLA+GW P + + Sbjct: 244 GLAAAVTTPLDVVKTQLQCQGVCGCDRFKSSSISDVFRTIVKKDGYRGLARGWLPRMLFH 303 Query: 427 SMQGLCKFGFYEVFKVAYAGMLDDETAS 510 + + YE K + + + A+ Sbjct: 304 APAAAICWSTYETVKSFFQDLNGEANAA 331 Score = 33.5 bits (73), Expect = 0.13 Identities = 22/70 (31%), Positives = 30/70 (42%) Frame = +1 Query: 289 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 468 P+D+VK RLQ+ YK V + K REEG + T + + F YE Sbjct: 152 PMDMVKQRLQIGNGTYKGVWDCIKRVTREEGFGAFYASYRTTVLMNAPFTAVHFTTYEAV 211 Query: 469 KVAYAGMLDD 498 K ML + Sbjct: 212 KRGLREMLPE 221 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 3/74 (4%) Frame = +1 Query: 274 HTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 444 H A+ P+D VK +Q K + F+ ++ +G L +G +G Sbjct: 53 HMAMFPVDTVKTHMQALRSCPIKPIGIRQAFRSIIKTDGPSALYRGIWAMGLGAGPAHAV 112 Query: 445 KFGFYEVFKVAYAG 486 F FYEV K +G Sbjct: 113 YFSFYEVSKKFLSG 126 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 43.2 bits (97), Expect = 2e-04 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = +1 Query: 277 TAVVPLDLVKCRLQVDAE----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 444 +A P+D+V+ RL V +Y+ + + +REEG R L +GW P+ IG Sbjct: 157 SATYPMDMVRGRLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGL 216 Query: 445 KFGFYEVFK 471 F YE K Sbjct: 217 NFSVYESLK 225 Score = 40.3 bits (90), Expect = 0.001 Identities = 27/69 (39%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = +1 Query: 265 GLTHTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 G++ TAV PL+ +K LQV KY V G K R EG+RGL KG Sbjct: 50 GVSRTAVAPLERMKILLQVQNPHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPN 109 Query: 436 GLCKFGFYE 462 KF YE Sbjct: 110 SAVKFFSYE 118 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 42.7 bits (96), Expect = 2e-04 Identities = 31/86 (36%), Positives = 41/86 (47%), Gaps = 6/86 (6%) Frame = +1 Query: 271 THTAVVPLDLVKCRLQVDAEK------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 432 T A+ LD+V+ R QV+ + YKN + R EG+RGL G+ P IG ++ Sbjct: 20 TVAAMHSLDVVRTRFQVNDGRGSSLPTYKNTAHAVFTIARLEGLRGLYAGFFPAVIGSTV 79 Query: 433 QGLCKFGFYEVFKVAYAGMLDDETAS 510 F FY K YA DDE S Sbjct: 80 SWGLYFFFYGRAKQRYARGRDDEKLS 105 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +1 Query: 268 LTHTAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 441 +T PLD++K RL V +YK V + K +REEG L KG P + + G Sbjct: 245 VTGVLTTPLDVIKTRLMVQGSGTQYKGVSDCIKTIIREEGSSALWKGMGPRVLWIGIGGS 304 Query: 442 CKFGFYEVFK 471 FG E K Sbjct: 305 IFFGVLEKTK 314 >At5g01340.1 68418.m00047 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 309 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 2/78 (2%) Frame = +1 Query: 289 PLDLVKCRLQVD-AEKYKNVVN-GFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 462 P+D++K RLQ+D YK + + G KV VR EGVR L KG P +++ + G Sbjct: 33 PIDVIKTRLQLDRVGAYKGIAHCGSKV-VRTEGVRALWKGLTPFATHLTLKYTLRMGSNA 91 Query: 463 VFKVAYAGMLDDETASLT 516 +F+ A+ D ET ++ Sbjct: 92 MFQTAFK---DSETGKVS 106 Score = 32.7 bits (71), Expect = 0.23 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = +1 Query: 283 VVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 414 V P ++VK RLQ + KYK ++ + VREE + GL G APT Sbjct: 126 VTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREESILGLWSGAAPT 175 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +1 Query: 289 PLDLVKCRLQV---DAE---KYKNVVNGFKVSVREEGVRGLAKGWAP 411 P D+VK RL D+E +YK +V+ + EEG+ L +G P Sbjct: 230 PFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLP 276 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 40.7 bits (91), Expect = 9e-04 Identities = 29/70 (41%), Positives = 38/70 (54%), Gaps = 9/70 (12%) Frame = +1 Query: 289 PLDLVKCRL----QVDA---EK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 441 PLDLV+ +L QV A E+ Y+ +V+ F + RE G RGL +G AP+ G Sbjct: 133 PLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARGLYRGVAPSLYGIFPYAG 192 Query: 442 CKFGFYEVFK 471 KF FYE K Sbjct: 193 LKFYFYEEMK 202 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = +1 Query: 265 GLTHTAVVPLDLVKCRLQVDAEKYKNV--VNGFKVSVREEGVRGLAKG 402 G+ TAV PL+ +K Q +++K + V + EG+ G +G Sbjct: 29 GIAKTAVAPLERIKILFQTRRDEFKRIGLVGSINKIGKTEGLMGFYRG 76 >At2g47490.1 68415.m05928 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 312 Score = 39.1 bits (87), Expect = 0.003 Identities = 29/86 (33%), Positives = 39/86 (45%), Gaps = 5/86 (5%) Frame = +1 Query: 271 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 T A PL +VK RLQ + YK+ + + EEG+RGL G P G S Sbjct: 127 TTIATNPLWVVKTRLQTQGMRVGIVPYKSTFSALRRIAYEEGIRGLYSGLVPALAGISHV 186 Query: 436 GLCKFGFYEVFKVAYAGMLDDETASL 513 + +F YE+ KV A D +L Sbjct: 187 AI-QFPTYEMIKVYLAKKGDKSVDNL 211 Score = 34.3 bits (75), Expect = 0.075 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +1 Query: 277 TAVVPLDLVKCRLQV-------DAE-KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 432 T V PLD++K R QV DA K +V + + EG+RGL +G +PT + Sbjct: 29 TFVCPLDVIKTRFQVHGLPKLGDANIKGSLIVGSLEQIFKREGMRGLYRGLSPTVMALLS 88 Query: 433 QGLCKFGFYEVFK 471 F Y+ K Sbjct: 89 NWAIYFTMYDQLK 101 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 2/76 (2%) Frame = +1 Query: 259 SCGLTHTAV-VPLDLVKCRLQV-DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 432 + G+T T + +PLD ++ +L E + F+ ++ EG+ L KG P+ ++ Sbjct: 150 AAGITATVLCLPLDTIRTKLVARGGEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMAL 209 Query: 433 QGLCKFGFYEVFKVAY 480 G +G Y++ K ++ Sbjct: 210 SGAVFYGVYDILKSSF 225 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 39.1 bits (87), Expect = 0.003 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 5/87 (5%) Frame = +1 Query: 271 THTAVVPLDLVKCRLQVDAEK-----YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 T A PL +VK RL + YK+V++ F EEGVRGL G P+ G S Sbjct: 131 TSIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPSLAGVSHV 190 Query: 436 GLCKFGFYEVFKVAYAGMLDDETASLT 516 + +F YE K A M + +L+ Sbjct: 191 AI-QFPAYEKIKQYMAKMDNTSVENLS 216 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 8/73 (10%) Frame = +1 Query: 277 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 432 T V PLD++K RLQV ++ ++ K ++EEG RG+ +G +PT I Sbjct: 33 TFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEGYRGMYRGLSPTIIALLP 92 Query: 433 QGLCKFGFYEVFK 471 F Y K Sbjct: 93 NWAVYFSVYGKLK 105 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Frame = +1 Query: 289 PLDLVKCRLQVDAE------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 450 P ++++ +LQ + KY V++ R EG+ GL +G A + + + F Sbjct: 237 PHEVIRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITF 296 Query: 451 GFYEVFKVAYAGMLDDET 504 YE+ + ++ ET Sbjct: 297 TTYEMMLRFFRQVVPPET 314 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +1 Query: 289 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 468 PLD ++ ++Q+ YK+V++ F + EGV GL +G+ P + K +++ Sbjct: 325 PLDTIRRQMQLKGTPYKSVLDAFSGIIAREGVVGLYRGFVPNALKSMPNSSIKLTTFDIV 384 Query: 469 K 471 K Sbjct: 385 K 385 >At3g54110.1 68416.m05982 plant uncoupling mitochondrial protein (PUMP) identical to plant uncoupling mitochondrial protein [Arabidopsis thaliana] GI:3115108 Length = 306 Score = 38.3 bits (85), Expect = 0.005 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 9/76 (11%) Frame = +1 Query: 286 VPLDLVKCRLQ---------VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQG 438 +PLD K RLQ V KY+ ++ REEG+R L KG P + G Sbjct: 30 IPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQCLFG 89 Query: 439 LCKFGFYEVFKVAYAG 486 + G YE K Y G Sbjct: 90 GLRIGMYEPVKNLYVG 105 Score = 35.9 bits (79), Expect = 0.025 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Frame = +1 Query: 289 PLDLVKCRLQVDAE-------KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 447 P DLVK RLQ + + +Y +N + VR+EGVR L G P ++ + Sbjct: 134 PTDLVKVRLQAEGKLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAE 193 Query: 448 FGFYEVFK 471 Y+ K Sbjct: 194 LASYDQVK 201 Score = 35.1 bits (77), Expect = 0.043 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +1 Query: 289 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 417 P+D+VK R+ D+ YK ++ F +++ +G KG+ P F Sbjct: 234 PVDVVKSRMMGDSGAYKGTIDCFVKTLKSDGPMAFYKGFIPNF 276 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 37.9 bits (84), Expect = 0.006 Identities = 22/81 (27%), Positives = 39/81 (48%) Frame = +1 Query: 271 THTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKF 450 + TA PLD +K LQ+ + + K+ ++ GVRG +G + + + KF Sbjct: 222 SRTATAPLDRLKVLLQIQKTDAR-IREAIKLIWKQGGVRGFFRGNGLNIVKVAPESAIKF 280 Query: 451 GFYEVFKVAYAGMLDDETASL 513 YE+FK A + ++ A + Sbjct: 281 YAYELFKNAIGENMGEDKADI 301 Score = 37.9 bits (84), Expect = 0.006 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNG-FKVSVREEGVRGLAKGWAPTFIGYSM 432 +S L T V PL +V+ R+Q AE+ + ++G F+ ++ EEG R L KG P + Sbjct: 411 ISGALGATCVYPLQVVRTRMQ--AERARTSMSGVFRRTISEEGYRALYKGLLPNLLKVVP 468 Query: 433 QGLCKFGFYEVFK 471 + YE K Sbjct: 469 AASITYMVYEAMK 481 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/72 (27%), Positives = 28/72 (38%), Gaps = 4/72 (5%) Frame = +1 Query: 268 LTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVRE----EGVRGLAKGWAPTFIGYSMQ 435 + ++ PLDLVK RLQ + V ++ EG R KG P+ +G Sbjct: 316 VAQASIYPLDLVKTRLQTYTSQAGVAVPRLGTLTKDILVHEGPRAFYKGLFPSLLGIIPY 375 Query: 436 GLCKFGFYEVFK 471 YE K Sbjct: 376 AGIDLAAYETLK 387 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +1 Query: 283 VVPLDLVKCRLQVDAEK---YKNVVNGFKVSVREEGVRGLAKGWAP 411 V P D+VK LQVD K Y ++ F+ ++ EGV+GL KG+ P Sbjct: 231 VYPTDVVKSVLQVDDYKNPRYTGSMDAFRKILKSEGVKGLYKGFGP 276 Score = 34.3 bits (75), Expect = 0.075 Identities = 32/90 (35%), Positives = 40/90 (44%), Gaps = 15/90 (16%) Frame = +1 Query: 289 PLDLVKCRLQ--------------VDAEKYKNVVNGFKVSVREEG-VRGLAKGWAPTFIG 423 P +L+KCRLQ V A KY ++ + +R EG RGL KG PTF Sbjct: 124 PTELIKCRLQAQGALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAR 183 Query: 424 YSMQGLCKFGFYEVFKVAYAGMLDDETASL 513 F YE FK AG +T+SL Sbjct: 184 EVPGNATMFAAYEAFKRFLAG--GSDTSSL 211 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 37.5 bits (83), Expect = 0.008 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 5/77 (6%) Frame = +1 Query: 256 LSCGLTHTA-----VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 420 LSCG+T A V PL +V+ R+Q D+ K + F +++ EG+RG +G P + Sbjct: 398 LSCGMTSGALGASCVYPLQVVRTRMQADSSK-TTMKQEFMNTMKGEGLRGFYRGLLPNLL 456 Query: 421 GYSMQGLCKFGFYEVFK 471 + YE K Sbjct: 457 KVVPAASITYIVYEAMK 473 Score = 32.3 bits (70), Expect = 0.30 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 3/71 (4%) Frame = +1 Query: 268 LTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVR---EEGVRGLAKGWAPTFIGYSMQG 438 L TA+ P+DLVK RLQ + +K++ EG R KG P+ +G Sbjct: 309 LAQTAIYPMDLVKTRLQTCVSEGGKAPKLWKLTKDIWVREGPRAFYKGLFPSLLGIVPYA 368 Query: 439 LCKFGFYEVFK 471 YE K Sbjct: 369 GIDLAAYETLK 379 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/77 (28%), Positives = 35/77 (45%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 L+ ++ TA PLD +K LQV + V+ K RE+ + G +G + + + Sbjct: 214 LAGAVSRTATAPLDRLKVVLQVQ-RAHAGVLPTIKKIWREDKLMGFFRGNGLNVMKVAPE 272 Query: 436 GLCKFGFYEVFKVAYAG 486 KF YE+ K G Sbjct: 273 SAIKFCAYEMLKPMIGG 289 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 37.5 bits (83), Expect = 0.008 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 5/84 (5%) Frame = +1 Query: 289 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 462 P DL++ L Q + + Y N+ + F V+ G++GL G +PT I +FG Y+ Sbjct: 146 PFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTYD 205 Query: 463 VFK---VAYAGMLDDETASLTVPS 525 FK + Y ++S T PS Sbjct: 206 TFKRWSMVYNKRYRSSSSSSTNPS 229 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%) Frame = +1 Query: 256 LSCGLTHTA-----VVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 420 L CG+T A V PL +++ R+Q D+ K ++ F ++R EG++G +G P F Sbjct: 397 LGCGMTSGALGASCVYPLQVIRTRMQADSSK-TSMGQEFLKTLRGEGLKGFYRGIFPNFF 455 Query: 421 GYSMQGLCKFGFYEVFK 471 + YE K Sbjct: 456 KVIPSASISYLVYEAMK 472 Score = 31.5 bits (68), Expect = 0.53 Identities = 22/73 (30%), Positives = 31/73 (42%) Frame = +1 Query: 268 LTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 447 ++ TA PLD +K LQV VV K RE+ + G +G + + K Sbjct: 217 VSRTATAPLDRLKVALQVQRTNL-GVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIK 275 Query: 448 FGFYEVFKVAYAG 486 F YE+ K G Sbjct: 276 FAAYEMLKPIIGG 288 Score = 30.3 bits (65), Expect = 1.2 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQ--VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYS 429 L+ + TA+ P+DLVK RLQ V + K +EG R +G P+ IG Sbjct: 304 LAGAVAQTAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIGII 363 Query: 430 MQGLCKFGFYEVFK 471 YE K Sbjct: 364 PYAGIDLAAYETLK 377 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 36.7 bits (81), Expect = 0.014 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAE--KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 426 L+ GL+ PLD+VK RLQV KYK ++ R+EG +G +G P + Y Sbjct: 260 LAGGLSAYLTTPLDVVKTRLQVQGSTIKYKGWLDAVGQIWRKEGPQGFFRGSVPRVMWY 318 >At1g07030.1 68414.m00749 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 326 Score = 36.7 bits (81), Expect = 0.014 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 7/88 (7%) Frame = +1 Query: 265 GLTHTAVVPLDLVKCRLQV------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 426 GL PLD+VK +LQ D ++ + + V+++G RGL +GW P + + Sbjct: 239 GLAAAVTTPLDVVKTQLQCQGVCGCDRFTSSSISHVLRTIVKKDGYRGLLRGWLPRMLFH 298 Query: 427 SMQGLCKFGFYEVFKVAYAGM-LDDETA 507 + + YE K + +D TA Sbjct: 299 APAAAICWSTYEGVKSFFQDFNVDSNTA 326 Score = 33.9 bits (74), Expect = 0.099 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +1 Query: 289 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVF 468 P+D+VK RLQ+ YK V + K +REEG+ + T + + F YE Sbjct: 150 PMDMVKQRLQMGEGTYKGVWDCVKRVLREEGIGAFYASYRTTVLMNAPFTAVHFATYEAA 209 Query: 469 K 471 K Sbjct: 210 K 210 Score = 28.7 bits (61), Expect = 3.7 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +1 Query: 274 HTAVVPLDLVKCRLQVDAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLC 444 H A+ P+D +K +Q K + F+ +++EG L +G +G Sbjct: 51 HMAMFPVDTIKTHMQALRPCPLKPVGIREAFRSIIQKEGPSALYRGIWAMGLGAGPAHAV 110 Query: 445 KFGFYEVFK 471 F FYEV K Sbjct: 111 YFSFYEVSK 119 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +1 Query: 289 PLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTF 417 P+D+VK R+ D+ Y+N V+ F +++ EG+ KG+ P F Sbjct: 236 PIDVVKSRMMGDST-YRNTVDCFIKTMKTEGIMAFYKGFLPNF 277 Score = 34.3 bits (75), Expect = 0.075 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +1 Query: 286 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 436 GLCKFGFYEVFKVAYAG 486 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 35.9 bits (79), Expect = 0.025 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 4/79 (5%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNG----FKVSVREEGVRGLAKGWAPTFIG 423 L+ G+TH PLD+VK RLQ+ + + G F ++ EG R L G P Sbjct: 76 LATGVTH----PLDVVKVRLQMQHVGQRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTR 131 Query: 424 YSMQGLCKFGFYEVFKVAY 480 + G + G YE KV++ Sbjct: 132 SVLYGGLRLGLYEPTKVSF 150 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 35.9 bits (79), Expect = 0.025 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAP 411 LS G+ PLD V+ ++Q+ YK++ F + +G+ GL +G+ P Sbjct: 286 LSAGIATLTCYPLDTVRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLP 337 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 8/83 (9%) Frame = +1 Query: 277 TAVVPLDLVKCRLQV--------DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSM 432 T PLD +K +Q A+K + + +EEGV+G KG P I Sbjct: 103 TVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLP 162 Query: 433 QGLCKFGFYEVFKVAYAGMLDDE 501 + YE +K + G DD+ Sbjct: 163 YSAVQLLAYESYKNLFKGK-DDQ 184 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 35.1 bits (77), Expect = 0.043 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%) Frame = +1 Query: 289 PLDLVKCRL--QVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYE 462 P DL++ L Q + + Y + + F ++ G+RGL G PT + +FG Y+ Sbjct: 151 PFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYD 210 Query: 463 VFK 471 +FK Sbjct: 211 MFK 213 Score = 30.7 bits (66), Expect = 0.93 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 16/71 (22%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAE----------------KYKNVVNGFKVSVREEGVR 387 +S G++ + PLD++K R QV E KY +V K REEG R Sbjct: 27 ISGGVSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQATKDIFREEGFR 86 Query: 388 GLAKGWAPTFI 420 G +G P + Sbjct: 87 GFWRGNVPALL 97 >At1g79900.1 68414.m09335 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 296 Score = 35.1 bits (77), Expect = 0.043 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +1 Query: 280 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFY 459 A PLD+VK RLQ Y+ + + F+ SV++EG L +G + F Y Sbjct: 217 ACYPLDVVKTRLQQGHGAYEGIADCFRKSVKQEGYTVLWRGLGTAVARAFVVNGAIFAAY 276 Query: 460 EV 465 EV Sbjct: 277 EV 278 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 34.7 bits (76), Expect = 0.057 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 9/77 (11%) Frame = +1 Query: 292 LDLVKCRLQVDAEK--------YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCK 447 LD + RL DA++ +K +++ ++ ++ +G++GL +G+ + +G ++ Sbjct: 136 LDYARTRLGTDAKECSVNGKRQFKGMIDVYRKTLSSDGIKGLYRGFGVSIVGITLYRGMY 195 Query: 448 FGFYEVFK-VAYAGMLD 495 FG Y+ K + G L+ Sbjct: 196 FGMYDTIKPIVLVGSLE 212 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 34.7 bits (76), Expect = 0.057 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNGFKVSV-REEGVRGLAKGWAPTFIGYSM 432 +S G+ P D++K R+ ++ VS+ R EG GL KG P F + Sbjct: 730 VSGGIAAVVTTPFDVMKTRMMTATPGRPISMSMVVVSILRNEGPLGLFKGAVPRFFWVAP 789 Query: 433 QGLCKFGFYEVFKVA 477 G F YE+ K A Sbjct: 790 LGAMNFAGYELAKKA 804 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 34.3 bits (75), Expect = 0.075 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +1 Query: 286 VPLDLVKCRLQV-------DAE---KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 +PLD K RLQ+ D E KY+ + REEG+ GL KG + Sbjct: 31 IPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGLWKGVIAGLHRQCIY 90 Query: 436 GLCKFGFYEVFKVAYAG 486 G + G YE K G Sbjct: 91 GGLRIGLYEPVKTLLVG 107 >At5g26200.1 68418.m03118 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 34.3 bits (75), Expect = 0.075 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 6/75 (8%) Frame = +1 Query: 265 GLTHTAVVPLDLVKCRLQV-DAE-----KYKNVVNGFKVSVREEGVRGLAKGWAPTFIGY 426 G + +P+D +K RLQV DAE + V+ K ++E GV +G P ++ Sbjct: 260 GCSALVTMPVDTIKTRLQVLDAEENGRRRAMTVMQSVKSLMKEGGVGACYRGLGPRWVSM 319 Query: 427 SMQGLCKFGFYEVFK 471 SM YE K Sbjct: 320 SMSATTMITTYEFLK 334 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 34.3 bits (75), Expect = 0.075 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = +1 Query: 265 GLTHTAV-VPLDLVKCRLQVDAEK--YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 GL T++ P D+VK R+ E Y+N + +V+ EG+R L KG+ PT+ Sbjct: 226 GLASTSLSCPADVVKTRMMNQGENAVYRNSYDCLVKTVKFEGIRALWKGFFPTWARLGPW 285 Query: 436 GLCKFGFYEVFKV 474 + YE F++ Sbjct: 286 QFVFWVSYEKFRL 298 Score = 31.5 bits (68), Expect = 0.53 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 8/49 (16%) Frame = +1 Query: 289 PLDLVKCRLQVDAE--------KYKNVVNGFKVSVREEGVRGLAKGWAP 411 P DLVK R+Q D +Y + F ++ EGV+GL KG P Sbjct: 134 PADLVKVRMQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLP 182 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 6/61 (9%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQV---DAEKYKNVVNGFKV---SVREEGVRGLAKGWAPTF 417 LS + + P+DL K R+Q+ + + + F V R+EGV GL KG +P Sbjct: 21 LSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAFGVVSEIARKEGVIGLYKGLSPAI 80 Query: 418 I 420 I Sbjct: 81 I 81 >At5g15640.1 68418.m01830 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 323 Score = 33.5 bits (73), Expect = 0.13 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = +1 Query: 265 GLTHTAVV-PLDLVKCRLQV--DAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQ 435 G T +++ PLD +K RLQV E + K + E+G +G +G P F S Sbjct: 245 GATASSITTPLDTIKTRLQVMGHQENRPSAKQVVKKLLAEDGWKGFYRGLGPRFFSMSAW 304 Query: 436 GLCKFGFYEVFK 471 G YE K Sbjct: 305 GTSMILTYEYLK 316 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 33.1 bits (72), Expect = 0.17 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +1 Query: 229 FRSLRSWWCLSCGLTHTAVVPLDLVKCRLQV---DAEKYKNVVNGFKVSVREEGVRGLAK 399 F S W ++ G A P+D V+ R+ + +A KYK+ + F V++EG + L K Sbjct: 291 FASFALGWLITNG-AGLASYPIDTVRRRMMMTSGEAVKYKSSFDAFSQIVKKEGAKSLFK 349 Query: 400 G 402 G Sbjct: 350 G 350 Score = 32.3 bits (70), Expect = 0.30 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 9/81 (11%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWA 408 +S ++ TA P++ VK +Q E YK + + F ++R+EG+ L +G Sbjct: 93 VSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEGIGSLWRGNT 152 Query: 409 PTFIGYSMQGLCKFGFYEVFK 471 I Y F F + FK Sbjct: 153 ANVIRYFPTQALNFAFKDYFK 173 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 32.7 bits (71), Expect = 0.23 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 6/60 (10%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVD-----AEKYKNVVNG-FKVSVREEGVRGLAKGWAPTF 417 L+ ++ TA PLDLV+ R+QV+ A Y + G FK + EG +G+ +G P + Sbjct: 252 LAGAVSSTATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEY 311 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 31.9 bits (69), Expect = 0.40 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 9/81 (11%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWA 408 +S ++ TA P++ VK +Q +E YK + + F +V++EG+ L +G Sbjct: 88 VSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEGMLALWRGNT 147 Query: 409 PTFIGYSMQGLCKFGFYEVFK 471 I Y F F + FK Sbjct: 148 ANVIRYFPTQALNFAFKDYFK 168 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +1 Query: 334 YKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFK 471 Y + ++ +E G RGL +G PT IG KF YE K Sbjct: 171 YSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELK 216 Score = 27.9 bits (59), Expect = 6.5 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +1 Query: 268 LTHTAVVPLDLVKCRLQVDAEKYK--NVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGL 441 + TAV PL+ +K LQ +K V K ++ +G G KG + I Sbjct: 36 IAKTAVAPLERIKILLQTRTNDFKTLGVSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAA 95 Query: 442 CKFGFYEVFK 471 + YEV++ Sbjct: 96 LHYMTYEVYR 105 >At2g22500.1 68415.m02669 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 313 Score = 30.3 bits (65), Expect = 1.2 Identities = 23/84 (27%), Positives = 41/84 (48%) Frame = +1 Query: 367 VREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGMLDDETASLTVPSCTWRRLA 546 +REEG+R L G + T + ++ + G Y++ K + D ET T+P +++ Sbjct: 72 IREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIKGEWT---DPETK--TMP--LMKKIG 124 Query: 547 SAELSPDIXPVAHGRPAXVRIQTM 618 + ++ I A G PA V + M Sbjct: 125 AGAIAGAIG-AAVGNPADVAMVRM 147 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 29.9 bits (64), Expect = 1.6 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 9/81 (11%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWA 408 +S ++ TA P++ VK +Q +E YK + + F ++++EG L +G Sbjct: 89 VSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNT 148 Query: 409 PTFIGYSMQGLCKFGFYEVFK 471 I Y F F + FK Sbjct: 149 ANVIRYFPTQALNFAFKDYFK 169 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 29.9 bits (64), Expect = 1.6 Identities = 21/81 (25%), Positives = 36/81 (44%), Gaps = 9/81 (11%) Frame = +1 Query: 256 LSCGLTHTAVVPLDLVKCRLQVD---------AEKYKNVVNGFKVSVREEGVRGLAKGWA 408 +S ++ TA P++ VK +Q +E YK + + F ++++EG L +G Sbjct: 89 VSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNT 148 Query: 409 PTFIGYSMQGLCKFGFYEVFK 471 I Y F F + FK Sbjct: 149 ANVIRYFPTQALNFAFKDYFK 169 >At2g26360.1 68415.m03164 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 303 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = +1 Query: 277 TAVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 420 T +P +++K RLQ A ++ N+V + +EG++GL +G T + Sbjct: 133 TLRIPCEVLKQRLQ--ANQFDNIVEATVSTWHQEGLKGLFRGTGVTLL 178 >At1g72820.1 68414.m08419 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 349 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 280 AVVPLDLVKCRLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIG 423 A+ P L+K R QV + + F + VR EG+RGL +G+ + +G Sbjct: 44 ALYPAVLMKTRQQVCHSQGSCIKTAFTL-VRHEGLRGLYRGFGTSLMG 90 >At5g67180.1 68418.m08469 AP2 domain-containing transcription factor, putative similar to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} Length = 352 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 255 SVMRSDPHGRGAPRPGEVSPP 317 SV +SDP G G P E+SPP Sbjct: 62 SVGKSDPSGSGRPEEPEISPP 82 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 29.5 bits (63), Expect = 2.1 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 7/57 (12%) Frame = +1 Query: 322 DAEKYKNVVNGF----KVSVREEGV-RGLAKGWAPTFI--GYSMQGLCKFGFYEVFK 471 DAE + +V+ G +++ + V R L +G+AP I GY M GLCK G + K Sbjct: 286 DAETFNDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAK 342 >At5g19760.1 68418.m02349 dicarboxylate/tricarboxylate carrier (DTC) identical to dicarboxylate/tricarboxylate carrier [Arabidopsis thaliana] GI:19913113 Length = 298 Score = 29.1 bits (62), Expect = 2.8 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 12/65 (18%) Frame = +1 Query: 262 CGLTHTAV-----VPLDLVKCRLQVD----AEKYKNVVNGFKVSVR---EEGVRGLAKGW 405 CGLT A+ P DL R+Q D + +N N F R +EGV L KG Sbjct: 111 CGLTAGAIGACVGSPADLALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGC 170 Query: 406 APTFI 420 PT + Sbjct: 171 GPTVV 175 >At4g34131.1 68417.m04841 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/75 (28%), Positives = 34/75 (45%) Frame = +1 Query: 310 RLQVDAEKYKNVVNGFKVSVREEGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKVAYAGM 489 R + EK + + GF+ V+ +G+ + +GWAP + Q C F V + + Sbjct: 325 RKNIGIEKEEWLPEGFEERVKGKGM--IIRGWAPQVLILDHQATCGF----VTHCGWNSL 378 Query: 490 LDDETASLTVPSCTW 534 L+ A L P TW Sbjct: 379 LEGVAAGL--PMVTW 391 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 6/81 (7%) Frame = +1 Query: 259 SCGLTHTAVV-PLDLVKCRLQVD-----AEKYKNVVNGFKVSVREEGVRGLAKGWAPTFI 420 + G T VV PLD+ RL D A +++ + + +++GVRG+ +G + Sbjct: 150 AAGCTALIVVYPLDIAHTRLAADIGKPEARQFRGIHHFLSTIHKKDGVRGIYRGLPASLH 209 Query: 421 GYSMQGLCKFGFYEVFKVAYA 483 G + FG ++ K ++ Sbjct: 210 GVIIHRGLYFGGFDTVKEIFS 230 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 289 PLDLVKCRLQ-VDAEKYKNVVNGFKVSVREEGVRGLAKGWAPT 414 P+D+VK R+ D E Y ++ V EEG L KG PT Sbjct: 268 PIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPT 310 >At1g79020.1 68414.m09214 transcription factor-related similar to enhancer of polycomb (GI:3757890) [Drosophila melanogaster]; similar to enhancer of polycomb (GI:11907923) [Homo sapiens] Length = 453 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 493 DDETASLTVPSCTWRRLASAELSPDIXPVAHGRPA 597 DDET + T + R+AS E+ ++ PV +PA Sbjct: 28 DDETPTSTTRNSQLLRIASVEVDNEVAPVPSKKPA 62 >At2g14770.2 68415.m01669 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1158 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -1 Query: 413 VGAHPLARPRTPSSRTDTLKPFTTFLYFSASTWRR-HFTRSRGTTAVWVRPHDRHHQLR 240 V AH + P P+S+T + F F W R FTR+ G A + P+D H +R Sbjct: 230 VAAH--SNPNRPTSKTVEMTKNLEF--FCKYPWGRVSFTRTLGRIANFQTPYDAHKLIR 284 >At2g14770.1 68415.m01668 Ulp1 protease family protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1139 Score = 28.3 bits (60), Expect = 4.9 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -1 Query: 413 VGAHPLARPRTPSSRTDTLKPFTTFLYFSASTWRR-HFTRSRGTTAVWVRPHDRHHQLR 240 V AH + P P+S+T + F F W R FTR+ G A + P+D H +R Sbjct: 230 VAAH--SNPNRPTSKTVEMTKNLEF--FCKYPWGRVSFTRTLGRIANFQTPYDAHKLIR 284 >At5g23940.1 68418.m02811 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 484 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 368 TDTLKPFTTFLYFSASTWRRHFTRSRG 288 +D+ KPF+TF ++ W RH T +RG Sbjct: 263 SDSSKPFSTFQSLTSHIW-RHVTLARG 288 >At4g15010.3 68417.m02307 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 6.5 Identities = 23/87 (26%), Positives = 33/87 (37%), Gaps = 2/87 (2%) Frame = +1 Query: 259 SCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSM 432 S L PLD +K +QV + K + + F +R G GL G +G Sbjct: 20 SVSLGTALAYPLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRIS 79 Query: 433 QGLCKFGFYEVFKVAYAGMLDDETASL 513 +FG YE+ Y D S+ Sbjct: 80 GFGARFGVYEILTAFYKDGRHDNYVSV 106 >At4g15010.2 68417.m02306 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 6.5 Identities = 23/87 (26%), Positives = 33/87 (37%), Gaps = 2/87 (2%) Frame = +1 Query: 259 SCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSM 432 S L PLD +K +QV + K + + F +R G GL G +G Sbjct: 20 SVSLGTALAYPLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRIS 79 Query: 433 QGLCKFGFYEVFKVAYAGMLDDETASL 513 +FG YE+ Y D S+ Sbjct: 80 GFGARFGVYEILTAFYKDGRHDNYVSV 106 >At4g15010.1 68417.m02305 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 378 Score = 27.9 bits (59), Expect = 6.5 Identities = 23/87 (26%), Positives = 33/87 (37%), Gaps = 2/87 (2%) Frame = +1 Query: 259 SCGLTHTAVVPLDLVKCRLQVDAEKYKNVVNG--FKVSVREEGVRGLAKGWAPTFIGYSM 432 S L PLD +K +QV + K + + F +R G GL G +G Sbjct: 20 SVSLGTALAYPLDTIKTIIQVGSGPNKKLSSFQVFNRVLRFSGYSGLYSGLGSLTLGRIS 79 Query: 433 QGLCKFGFYEVFKVAYAGMLDDETASL 513 +FG YE+ Y D S+ Sbjct: 80 GFGARFGVYEILTAFYKDGRHDNYVSV 106 >At4g37590.1 68417.m05320 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 580 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -2 Query: 307 TSPGRGAPRPCGSDRMTDTTNSAKSEIFRRSKFTGLRGYRSRRRHATGLLDSH 149 +S G P + R T+TT+ +E + LRG + R A +SH Sbjct: 472 SSTGNSTPEVIPASRSTNTTDQEDTECWDTEDIKALRGELANLRLAKNQQESH 524 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,306,112 Number of Sequences: 28952 Number of extensions: 285558 Number of successful extensions: 881 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -