BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060468.seq (686 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 69 3e-12 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 69 4e-12 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 69 4e-12 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 66 2e-11 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 63 1e-10 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 62 4e-10 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 57 1e-08 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 55 5e-08 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 52 4e-07 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 51 8e-07 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 51 8e-07 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 51 8e-07 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 51 8e-07 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 51 8e-07 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 51 8e-07 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 50 1e-06 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 50 1e-06 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 50 1e-06 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 50 1e-06 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 50 1e-06 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 50 2e-06 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 50 2e-06 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 50 2e-06 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 50 2e-06 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 49 3e-06 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 48 4e-06 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 48 4e-06 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 48 4e-06 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 48 6e-06 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 48 6e-06 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 48 8e-06 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 47 1e-05 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 47 1e-05 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 46 2e-05 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 46 2e-05 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 46 3e-05 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 46 3e-05 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 45 5e-05 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 44 7e-05 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 44 7e-05 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 44 9e-05 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 44 1e-04 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 44 1e-04 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 44 1e-04 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 43 2e-04 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 43 2e-04 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 43 2e-04 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 43 2e-04 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 43 2e-04 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 42 3e-04 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 42 3e-04 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 42 4e-04 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 42 5e-04 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 41 7e-04 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 41 7e-04 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 41 7e-04 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 41 7e-04 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 41 9e-04 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 41 9e-04 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 41 9e-04 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 41 9e-04 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 41 9e-04 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 41 9e-04 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 41 9e-04 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 41 9e-04 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 41 9e-04 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 41 9e-04 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 40 0.001 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 40 0.001 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 40 0.001 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 40 0.002 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 40 0.002 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 40 0.002 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 40 0.002 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 40 0.002 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 40 0.002 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 40 0.002 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 39 0.003 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 39 0.003 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 39 0.004 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 39 0.004 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 39 0.004 At5g51300.2 68418.m06360 splicing factor-related contains simila... 38 0.005 At5g51300.1 68418.m06359 splicing factor-related contains simila... 38 0.005 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 38 0.005 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 38 0.005 At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 38 0.005 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 38 0.005 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 38 0.005 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 38 0.005 At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing ... 38 0.006 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 38 0.006 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 38 0.006 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 38 0.006 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 38 0.006 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 38 0.006 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 38 0.008 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 38 0.008 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 38 0.008 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 38 0.008 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 38 0.008 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 37 0.011 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 37 0.011 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 37 0.011 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 37 0.011 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 37 0.011 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 37 0.011 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 37 0.011 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 37 0.011 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 37 0.011 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 37 0.011 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 36 0.019 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 36 0.019 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 36 0.019 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 36 0.019 At2g47310.1 68415.m05906 flowering time control protein-related ... 36 0.025 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 36 0.025 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 36 0.033 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 36 0.033 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 36 0.033 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 36 0.033 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 35 0.044 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 35 0.044 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 35 0.044 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 35 0.044 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 35 0.058 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 35 0.058 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 35 0.058 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 34 0.077 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 34 0.077 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 34 0.077 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 34 0.077 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 34 0.10 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 34 0.10 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 34 0.10 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 34 0.10 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 34 0.10 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 34 0.10 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 33 0.13 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 33 0.13 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 33 0.13 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 33 0.13 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 33 0.13 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 33 0.18 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 33 0.23 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 32 0.31 At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing ... 32 0.41 At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing ... 32 0.41 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 32 0.41 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 32 0.41 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 32 0.41 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 32 0.41 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 31 0.72 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 31 0.72 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 31 0.72 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 31 0.72 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 31 0.95 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 30 1.3 At3g14450.1 68416.m01831 RNA-binding protein, putative contains ... 30 1.3 At1g73490.1 68414.m08508 RNA recognition motif (RRM)-containing ... 30 1.3 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 30 1.3 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 30 1.3 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 30 1.3 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 30 1.3 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 30 1.3 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 30 1.7 At5g03480.1 68418.m00304 expressed protein ; expression support... 30 1.7 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 30 1.7 At1g63610.2 68414.m07192 expressed protein 30 1.7 At1g63610.1 68414.m07191 expressed protein 30 1.7 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 30 1.7 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 29 2.2 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 29 2.2 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 29 2.2 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 29 2.2 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 29 2.2 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 29 2.2 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 29 2.9 At3g45850.1 68416.m04962 kinesin motor protein-related kinesin-r... 29 2.9 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 29 3.8 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 29 3.8 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 29 3.8 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 29 3.8 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 5.0 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 28 5.0 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 28 5.0 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 28 5.0 At5g53700.1 68418.m06672 hypothetical protein 28 6.7 At4g08750.1 68417.m01443 RNA recognition motif (RRM)-containing ... 28 6.7 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 28 6.7 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 28 6.7 At2g31920.1 68415.m03899 expressed protein 27 8.8 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 27 8.8 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 68.9 bits (161), Expect = 3e-12 Identities = 33/58 (56%), Positives = 40/58 (68%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LRR FE+ G V DIY+PRD YT + RGF F++F + DA EA MDG +L GREL V Sbjct: 53 LRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTV 110 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 68.5 bits (160), Expect = 4e-12 Identities = 29/56 (51%), Positives = 45/56 (80%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +F + G+V D++IPRDR T +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ Sbjct: 35 LFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQ 90 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 173 YGRP-PPRIDGMVSLKVDNLTYRTTPED-YAAFSK 271 +GR PP I SL V N+T+RTT +D Y F+K Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAK 38 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 68.5 bits (160), Expect = 4e-12 Identities = 29/56 (51%), Positives = 45/56 (80%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +F + G+V D++IPRDR T +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ Sbjct: 35 LFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQ 90 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 173 YGRP-PPRIDGMVSLKVDNLTYRTTPED-YAAFSK 271 +GR PP I SL V N+T+RTT +D Y F+K Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAK 38 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 66.5 bits (155), Expect = 2e-11 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR+ FE+ G V DIY+PRD YT + RGF FV+F + DA +A MDG +L GREL V Sbjct: 52 LRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTV 109 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 63.3 bits (147), Expect = 1e-10 Identities = 31/58 (53%), Positives = 38/58 (65%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR FER G V D+YIPRD Y+ + RGFAFV F + DA EA +M+ R GRE+ V Sbjct: 63 LREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITV 120 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 61.7 bits (143), Expect = 4e-10 Identities = 30/64 (46%), Positives = 42/64 (65%) Frame = +1 Query: 235 PNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 PND LR FER G + DIY+PR+ YT E RGF FV++ DA EA+ M+ +++ GR Sbjct: 60 PND---LRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIGGR 116 Query: 415 ELRV 426 E+ + Sbjct: 117 EIAI 120 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 57.2 bits (132), Expect = 1e-08 Identities = 27/60 (45%), Positives = 36/60 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 LR F G V D + RDRYT SRGF FV + +AE A+ MDG+ L+GR + V++ Sbjct: 19 LREAFSGYGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKL 78 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 54.8 bits (126), Expect = 5e-08 Identities = 24/60 (40%), Positives = 40/60 (66%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 + +F G+V + + +DR+TR+SRG AFV + R DA +A +MD ++L+GR+L V + Sbjct: 73 IHTLFSTFGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSI 132 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/58 (46%), Positives = 34/58 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+ F GEV ++ I D+ + SRGF FV F E DA A D MDG+ L GR LR+ Sbjct: 57 LKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRI 114 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 50.8 bits (116), Expect = 8e-07 Identities = 24/64 (37%), Positives = 37/64 (57%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D+ RL R+F G+V D + DR T SRGF FV+ + A+ +DG+ L+GR + Sbjct: 219 DSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQNLEGRAI 278 Query: 421 RVQM 432 +V + Sbjct: 279 KVNV 282 Score = 36.7 bits (81), Expect = 0.014 Identities = 21/62 (33%), Positives = 34/62 (54%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D+ L +FE+ G V + +R T +SRGF FV +AE+A++ + ++GR L Sbjct: 125 DSQALAMLFEQAGTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRL 184 Query: 421 RV 426 V Sbjct: 185 TV 186 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 50.8 bits (116), Expect = 8e-07 Identities = 22/60 (36%), Positives = 39/60 (65%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 RL++VF G+V ++ I + TR+S G+ +V F + DA+ A++ M+G+ DGR + V+ Sbjct: 92 RLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAMNGKFFDGRFILVK 151 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 50.8 bits (116), Expect = 8e-07 Identities = 21/60 (35%), Positives = 39/60 (65%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L+R F GE+ ++ + +D + S+G+AF++F + DA A++TMD RM +GR + + + Sbjct: 56 LKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDI 115 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/60 (41%), Positives = 35/60 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L++ F GEV + + DR T SRGF FV F A A+ MDG+ L+GR++RV + Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNL 110 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/60 (41%), Positives = 35/60 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L++ F GEV + + DR T SRGF FV F A A+ MDG+ L+GR++RV + Sbjct: 51 LKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNL 110 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/58 (43%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L F G++ D+ P D+ ++ R F FV F ER DA A+D MDG L GR L V Sbjct: 29 LHAAFIPFGDIKDVKTPLDQANQKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTV 86 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/58 (44%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR F + GEV D + DR T SRGF FV F A A+ +DGR L GR ++V Sbjct: 56 LREAFTKYGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKV 113 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/58 (48%), Positives = 34/58 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR F + GEV D I DR T SRGFAFV F +A A+ +DG+ L GR +RV Sbjct: 50 LREAFSKYGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQ-LDGQDLHGRRIRV 106 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/59 (38%), Positives = 35/59 (59%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +L +F R GE+ I + D+ T+ GF FV F+ R D E+A+ + G +LD R +RV Sbjct: 49 QLYELFSRAGEIKKIIMGLDKNTKTPCGFCFVLFYSREDTEDAVKYISGTILDDRPIRV 107 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/58 (44%), Positives = 33/58 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR F G+V D + DR T SRGF FV F + A A+ MDG+ L+GR +RV Sbjct: 51 LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRV 108 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/58 (44%), Positives = 33/58 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR F G+V D + DR T SRGF FV F + A A+ MDG+ L+GR +RV Sbjct: 51 LRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRV 108 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+R F + G+V D I DR + SRGF FV F + + +A++ M+G+ LDGR + V Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+R F + G+V D I DR + SRGF FV F + + +A++ M+G+ LDGR + V Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+R F + G+V D I DR + SRGF FV F + + +A++ M+G+ LDGR + V Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITV 79 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/60 (35%), Positives = 39/60 (65%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 LR++F G++ + + RD T+ +GF F+ F DA +AL ++DG+++DGR + V++ Sbjct: 23 LRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEV 82 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/58 (37%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR FE+ G + + + D+++ SRGF F+ F E++ +EA+ M+G LDGR + V Sbjct: 23 LRDAFEKYGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITV 80 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 48.4 bits (110), Expect = 4e-06 Identities = 23/61 (37%), Positives = 36/61 (59%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 RL ++F G+V + + DR T SRGF FV + + EA+ +DG+ L+GR +RV Sbjct: 259 RLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVN 318 Query: 430 M 432 + Sbjct: 319 V 319 Score = 34.7 bits (76), Expect = 0.058 Identities = 21/58 (36%), Positives = 31/58 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +FE+ G V + +R T +SRGF FV +AE A++ + L+GR L V Sbjct: 166 LAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTV 223 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 48.4 bits (110), Expect = 4e-06 Identities = 22/75 (29%), Positives = 44/75 (58%) Frame = +1 Query: 208 LVKSR*SYLPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDT 387 L SR +Y +++ +++R FE G + +++ D+ T + +G+AF+ + RD + A Sbjct: 140 LFVSRLNYESSES-KIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQ 198 Query: 388 MDGRMLDGRELRVQM 432 DG+ +DGR + V + Sbjct: 199 ADGQKIDGRRVLVDV 213 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 48.4 bits (110), Expect = 4e-06 Identities = 25/59 (42%), Positives = 32/59 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 + R F GEV D I DR T S+GF FV F + A+D M+G+ LDGR + Q Sbjct: 60 IERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFKDEDSMRTAIDRMNGQELDGRNITAQ 118 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L F + G+V D I DR T SRGF FV F + + ++A++ M+G+ LDGR + V Sbjct: 24 LETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITV 81 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 48.0 bits (109), Expect = 6e-06 Identities = 24/58 (41%), Positives = 35/58 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L F + G+V D I DR T SRGF FV F + + ++A++ M+G+ LDGR + V Sbjct: 24 LETAFAQYGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITV 81 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 47.6 bits (108), Expect = 8e-06 Identities = 22/53 (41%), Positives = 31/53 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LR F + GEV D + DR + S+GF FVR+ D+ + + MDG+ LDG Sbjct: 72 LRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAGMDGKFLDG 124 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/58 (36%), Positives = 39/58 (67%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L VF + GE+ D+ + RD+ T +S+GFAF+ + ++R A+D ++G ++ GR ++V Sbjct: 52 LLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKV 109 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/58 (37%), Positives = 34/58 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L F +CG+V + I DR + S+GF FV F +A++AL +G+ L+GR + V Sbjct: 50 LSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFV 107 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 L +F G V +Y+ D+ T SRGF FV F R DA+ A++ ++G D LRV+ Sbjct: 229 LMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVE 287 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 46.0 bits (104), Expect = 2e-05 Identities = 22/60 (36%), Positives = 34/60 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L F CG+V + D T SRG+ FV + + + E AL+++DG L+GR +RV + Sbjct: 193 LAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETALESLDGFELEGRAIRVNL 252 Score = 33.5 bits (73), Expect = 0.13 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +R T +SRGFAFV D +D +DG GR L+V Sbjct: 119 NRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKV 158 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/58 (39%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L R F R G++ D I +R T SRGF F+ F +RR +E++ M GR R + V Sbjct: 23 LERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISV 80 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 45.6 bits (103), Expect = 3e-05 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLD--GRELRV 426 LR F + + D+ + RD++T SRGFAFV F+ DA +AL+ + L+ G+ LRV Sbjct: 474 LRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRV 533 Score = 31.5 bits (68), Expect = 0.54 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTM--DGRMLDGREL 420 L ++ G + + + R++ + SRGFAF+ F A +D + DG +LDGR+L Sbjct: 314 LYQILAEWGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEHDGIVLDGRKL 371 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 44.8 bits (101), Expect = 5e-05 Identities = 24/62 (38%), Positives = 33/62 (53%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D+ +L ++FE G V + + D+ T SRGF FV + E A +G LDGR L Sbjct: 103 DSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPL 162 Query: 421 RV 426 RV Sbjct: 163 RV 164 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/58 (34%), Positives = 35/58 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F G+V + + DR + S+GF FV + ++ + A+ ++DG LDGR++RV Sbjct: 220 LESLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRV 277 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 F + G+V D+++ D +TRESRGF F+ DA + ++D +L GR + V+ Sbjct: 65 FAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVE 119 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/55 (36%), Positives = 33/55 (60%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 F + G+V D+++ D +TRESRGF F+ DA + ++D +L GR + V+ Sbjct: 95 FAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVE 149 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/58 (36%), Positives = 34/58 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 ++ VF G V D++IP++ T +GFAFV+F ++DA A+ +G M R + V Sbjct: 347 IKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAV 404 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +L F G V ++ ++ + E RGFAFV+F + D A++ +G + GR + V+ Sbjct: 35 QLEEAFSEVGPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVK 94 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/51 (35%), Positives = 34/51 (66%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM 402 RL++VF G+V ++ I + TR+S G+ +V F + DA+ A++ M+G++ Sbjct: 73 RLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNSKEDAQSAVEAMNGKV 123 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 43.6 bits (98), Expect = 1e-04 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = +1 Query: 238 NDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 N+A L+ +F GEV + I DR RG +V F R DAE+A MDG +DG+ Sbjct: 110 NEA-HLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYMDGAQIDGKV 168 Query: 418 LR 423 ++ Sbjct: 169 VK 170 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 43.6 bits (98), Expect = 1e-04 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = +1 Query: 238 NDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 N+A L+ +F GEV + I DR RG +V F R DAE+A MDG +DG+ Sbjct: 110 NEA-HLKEIFGNFGEVIHVEIAMDRAVNLPRGHGYVEFKARADAEKAQLYMDGAQIDGKV 168 Query: 418 LR 423 ++ Sbjct: 169 VK 170 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/58 (32%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F G+V + + DR + S+GF FV ++ ++A+++++G LDGR++RV Sbjct: 265 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 322 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/62 (35%), Positives = 32/62 (51%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D+ +L ++FE G V + + D+ T SRGF FV + E A +G +GR L Sbjct: 111 DSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPL 170 Query: 421 RV 426 RV Sbjct: 171 RV 172 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/58 (32%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F G+V + + DR + S+GF FV ++ ++A+++++G LDGR++RV Sbjct: 273 LENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRV 330 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/62 (35%), Positives = 32/62 (51%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D+ +L ++FE G V + + D+ T SRGF FV + E A +G +GR L Sbjct: 111 DSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPL 170 Query: 421 RV 426 RV Sbjct: 171 RV 172 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +L F+R G++ + I R T RGF F+ F +RR A++A+ M GR L + + V Sbjct: 27 QLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISV 85 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/59 (35%), Positives = 33/59 (55%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +L F+R G++ + I R T RGF F+ F +RR A++A+ M GR L + + V Sbjct: 27 QLESTFDRYGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISV 85 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/59 (33%), Positives = 34/59 (57%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 LR FE+ G + + + D+ +GFAF+R+ +A +A+ M G+ LDGR + V+ Sbjct: 93 LRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVE 151 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/59 (37%), Positives = 32/59 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 L +F G V ++ D+ T SRGF FV F R DA+ A++ ++G D LRV+ Sbjct: 190 LMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVE 248 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 423 VF C D + D+ T SRGF FV F ++DA+ A++ M+G+ L R++R Sbjct: 166 VFSSCS---DARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIR 216 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/58 (29%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+ +F G V + R ++ + FV +F+RR A A+ +++GR L G+ ++V Sbjct: 75 LQEIFTSTGPVESSKLIR----KDKSSYGFVHYFDRRSAALAILSLNGRHLFGQPIKV 128 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L ++F G V D+ I D+ T SRGF FV +A+EA+ + + GR ++V Sbjct: 132 LSQIFGEAGTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 +R T SRGF F+ F + + AL TM+G ++GR LR+ + Sbjct: 253 ERNTGRSRGFGFISFESAENVQSALATMNGVEVEGRALRLNL 294 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 41.5 bits (93), Expect = 5e-04 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 LR F +CGEV +++P DR T SRGFA++ D EAL + G + G + V+ Sbjct: 499 LRSHFSKCGEVTRVHVPTDRETGASRGFAYIDLTSGFD--EALQ-LSGSEIGGGNIHVE 554 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/53 (33%), Positives = 33/53 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LR FE GE+ ++ I D+ ++ S+G+AF+ + A AL M+G++++G Sbjct: 298 LRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTTEEAAGTALKEMNGKIING 350 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRML 405 L F GEV + + R++ T +S G+ FV F R AEE L G ++ Sbjct: 124 LHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRAAAEEVLQNYSGSVM 174 Score = 34.3 bits (75), Expect = 0.077 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 D T S+G+ FVRF + + AL M+G R++RV Sbjct: 237 DSNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRV 276 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F + G V ++Y+P+DR T + + F+ + DA+ A+ ++ L G+ +RV Sbjct: 41 LWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRV 98 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 298 IPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 I RD T SRGF F+ + ++ A+++M G+ L R++ V Sbjct: 144 IMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQITV 186 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 41.1 bits (92), Expect = 7e-04 Identities = 23/58 (39%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR+VFE G V + +PRD T +GF FV+F DA AL+ + GR ++V Sbjct: 301 LRKVFESFGSVELVQVPRDE-TGLCKGFGFVQFARLEDARNALNLNGQLEIAGRAIKV 357 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/63 (36%), Positives = 34/63 (53%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D RLR F G+V + I RDR T +RGF F+ F + +E + MD ++DGR + Sbjct: 18 DEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI--MDKHIIDGRTV 75 Query: 421 RVQ 429 + Sbjct: 76 EAK 78 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/63 (36%), Positives = 34/63 (53%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D RLR F G+V + I RDR T +RGF F+ F + +E + MD ++DGR + Sbjct: 18 DEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI--MDKHIIDGRTV 75 Query: 421 RVQ 429 + Sbjct: 76 EAK 78 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/63 (36%), Positives = 34/63 (53%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D RLR F G+V + I RDR T +RGF F+ F + +E + MD ++DGR + Sbjct: 18 DEERLRDYFSNYGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI--MDKHIIDGRTV 75 Query: 421 RVQ 429 + Sbjct: 76 EAK 78 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 40.7 bits (91), Expect = 9e-04 Identities = 22/63 (34%), Positives = 35/63 (55%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D RL+ F + G++ + I RDR T +RGF F+ F + AE + MD ++DGR + Sbjct: 27 DEERLQEYFGKYGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI--MDKHIIDGRTV 84 Query: 421 RVQ 429 + Sbjct: 85 EAK 87 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/48 (37%), Positives = 30/48 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 + +F + G V D+Y+ RD Y R+SRG FV++ + A A+D ++G Sbjct: 227 VEEIFLQFGHVEDVYLMRDEY-RQSRGCGFVKYSSKETAMAAIDGLNG 273 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/50 (26%), Positives = 30/50 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM 402 +R FE+ G V ++ + +D+ T + +G FV++ +DA+ A+ + ++ Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQI 185 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/48 (37%), Positives = 30/48 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 + +F + G V D+Y+ RD Y R+SRG FV++ + A A+D ++G Sbjct: 227 VEEIFLQFGHVEDVYLMRDEY-RQSRGCGFVKYSSKETAMAAIDGLNG 273 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/50 (26%), Positives = 30/50 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM 402 +R FE+ G V ++ + +D+ T + +G FV++ +DA+ A+ + ++ Sbjct: 136 IRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQI 185 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 40.7 bits (91), Expect = 9e-04 Identities = 17/60 (28%), Positives = 37/60 (61%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 LR + E GE+ ++ + +DR + +S+G+AFV F + A++A++ + + G+ +R + Sbjct: 132 LRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSL 191 Score = 31.5 bits (68), Expect = 0.54 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +L+ +F+R GEV I P + + R F FV + ER A +A+ + ++G+ L V Sbjct: 307 QLKELFQRHGEVTKIVTPPGKGGK--RDFGFVHYAERSSALKAVKDTERYEVNGQPLEV 363 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 40.7 bits (91), Expect = 9e-04 Identities = 19/58 (32%), Positives = 36/58 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L++VF GEV ++ I ++ T++S+G AF+RF A+ A+ + M++G++ V Sbjct: 230 LKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGV 287 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 40.7 bits (91), Expect = 9e-04 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 L R+F R G V D+ + RD +AFV F + RDA++A +DGR DG + V+ Sbjct: 27 LERLFSRYGRVRDVDMKRD--------YAFVEFGDPRDADDARHYLDGRDFDGSRITVE 77 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 40.7 bits (91), Expect = 9e-04 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 423 F D + D+ T SRGF FV F ++DA+ A++ M+G+ + R++R Sbjct: 168 FSAFNSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIR 220 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+ +F G + + R ++ + FV +F+RR A A+ T++GR + G+ ++V Sbjct: 79 LQEIFASTGPIESCKLIR----KDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKV 132 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 256 RRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL-DTMD 393 R FER GE+ D+Y+P+D +++ RG F+ F E+ + DT D Sbjct: 108 RSHFERYGEITDLYMPKDYNSKQHRGIGFITFSSADSVEDLMEDTHD 154 Score = 35.9 bits (79), Expect = 0.025 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 D+ L+ + G++ D + +DR T SRGF +V F DA+ AL Sbjct: 15 DSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL 61 Score = 35.5 bits (78), Expect = 0.033 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAE 372 LR F R G + D YIP+D RGF FV F E A+ Sbjct: 256 LRDYFGRFGHIQDAYIPKDPKRSGHRGFGFVTFAENGVAD 295 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/59 (38%), Positives = 33/59 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 L R+F R G V D+ + RD +AFV F + RDA++A +DGR DG + V+ Sbjct: 27 LERLFSRYGRVRDVDMKRD--------YAFVEFSDPRDADDARYYLDGRDFDGSRITVE 77 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +1 Query: 289 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 423 D + D+ T SRGF FV F ++DA+ A+D + G+ L R++R Sbjct: 167 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIR 211 Score = 32.7 bits (71), Expect = 0.23 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+ VF G V + R +E + FV +F+RR A A+ +++GR L G+ ++V Sbjct: 70 LQEVFAGTGPVESCKLIR----KEKSSYGFVHYFDRRSAGLAILSLNGRHLFGQPIKV 123 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 L+R F + G+V D I DR + SRGF FV F + + +A++ M+G Sbjct: 22 LQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFKDEKAMRDAIEEMNG 69 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = +1 Query: 289 DIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 423 D + D+ T SRGF FV F ++DA+ A++ M+G+ + R++R Sbjct: 180 DARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIR 224 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+ +F G + + R ++ + FV +F+RR A A+ T++GR + G+ ++V Sbjct: 79 LQEIFASTGPIESCKLIR----KDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKV 132 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/60 (30%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM-LDGRELRV 426 +LR++FE G V + +P D T + +GF F++F + ++ A ++G++ + GR ++V Sbjct: 280 QLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAGRTIKV 339 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/61 (27%), Positives = 33/61 (54%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +L ++ E G V + + D+Y+ SR F F DA ++ ++G ++GRE++V Sbjct: 91 QLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVN 150 Query: 430 M 432 + Sbjct: 151 I 151 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F G+V + R T +S GF FV F D E A+ ++ +L+G+++RV Sbjct: 193 LENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRV 250 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/67 (35%), Positives = 34/67 (50%) Frame = +1 Query: 232 LPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LP D R R V + + G + + G+AFV F + RDAE+A+ DG DG Sbjct: 14 LPGDI-REREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDG 72 Query: 412 RELRVQM 432 LRV++ Sbjct: 73 HRLRVEL 79 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/67 (35%), Positives = 34/67 (50%) Frame = +1 Query: 232 LPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LP D R R V + + G + + G+AFV F + RDAE+A+ DG DG Sbjct: 14 LPGDI-REREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDG 72 Query: 412 RELRVQM 432 LRV++ Sbjct: 73 HRLRVEL 79 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/67 (35%), Positives = 34/67 (50%) Frame = +1 Query: 232 LPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LP D R R V + + G + + G+AFV F + RDAE+A+ DG DG Sbjct: 14 LPGDI-REREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDG 72 Query: 412 RELRVQM 432 LRV++ Sbjct: 73 HRLRVEL 79 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/60 (35%), Positives = 34/60 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L F+ G V + D+ T S+ F FV + + A+ A+D M+GR L G++L+VQ+ Sbjct: 365 LAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQL 424 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 39.1 bits (87), Expect = 0.003 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 +RR FE+ GE+ + + D+ T S+G+ FV F E A A M+ ++DGR Sbjct: 38 MRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFKEAEAAMRACQNMN-PVIDGR 90 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/54 (31%), Positives = 33/54 (61%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 L + F + G+V + + D+ +GFA+V F + +AE+AL ++ +++DGR Sbjct: 37 LTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGR 90 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/59 (37%), Positives = 34/59 (57%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 LR +F+ GEV + R T R FV FF+ RDA +AL M+G+++ G+ + +Q Sbjct: 199 LRHIFQVYGEVKQV-----RETPCKREQRFVEFFDVRDAAKALRVMNGKVISGKPMVIQ 252 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 F+ GEV D+ +R RGF V F +A++AL+ GR L GRE+R+ + Sbjct: 317 FKEAGEVVDVRFSTNRDDGSFRGFGHVEFASSEEAQKALE-FHGRPLLGREIRLDI 371 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMD 393 LR F CGE+ ++ +P DR T S+G A++ F E ++ L+ D Sbjct: 421 LREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEFSEGKEKALELNGSD 467 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/60 (31%), Positives = 34/60 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L +F GE+ + +DR T S+G+ FV++ + + A A+ M+G +GR L V++ Sbjct: 496 LINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRI 555 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/60 (31%), Positives = 34/60 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L +F GE+ + +DR T S+G+ FV++ + + A A+ M+G +GR L V++ Sbjct: 496 LINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRI 555 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 F + G+V ++ + TR SRGFAFV +DAE + ++ +L+GR Sbjct: 92 FAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 141 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 F + G+V ++ + TR SRGFAFV +DAE + ++ +L+GR Sbjct: 91 FAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 140 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/55 (29%), Positives = 34/55 (61%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 F + GE+ D I RDR+T + RGF F+ F + ++ ++ D +++G+++ ++ Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE--DTHVINGKQVEIK 91 Score = 35.9 bits (79), Expect = 0.025 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTM--DGRMLDGRELRV 426 L+ F + G V + + RD T SRGF FV F D+EE +D + G M+D + +V Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIF----DSEEVVDELLSKGNMIDMADTQV 180 Query: 427 QM 432 ++ Sbjct: 181 EI 182 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/55 (29%), Positives = 34/55 (61%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 F + GE+ D I RDR+T + RGF F+ F + ++ ++ D +++G+++ ++ Sbjct: 39 FGKYGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVIE--DTHVINGKQVEIK 91 Score = 35.5 bits (78), Expect = 0.033 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTM--DGRMLDGRELRV 426 L+ F + G V + + RD T SRGF FV F D+EE +D + G M+D + +V Sbjct: 125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIF----DSEEVVDELLSKGNMIDMADTQV 180 Query: 427 QM 432 + Sbjct: 181 SL 182 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 38.3 bits (85), Expect = 0.005 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 +L+ F G++ D + DR + S+GF FV + DAE+A M+ + LDG Sbjct: 49 KLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMNAKFLDG 102 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/63 (33%), Positives = 35/63 (55%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D +L +F+ G V + + R+ T ESRG +V A+ A+ ++DG + GRE+ Sbjct: 120 DIAQLLDMFQPFGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREM 179 Query: 421 RVQ 429 RV+ Sbjct: 180 RVR 182 >At5g05720.1 68418.m00629 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/61 (31%), Positives = 37/61 (60%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 RLR VF R GE+ D+ + R + +SR FA++ F ++A++A+ ++ +D + V+ Sbjct: 18 RLRDVFSRKGEIADVKLKR-KSDGKSRQFAYIGFRTEQEAQDAITYVNKCFIDTYRISVE 76 Query: 430 M 432 + Sbjct: 77 V 77 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 37.9 bits (84), Expect = 0.006 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F + G V + + RD R SRGF FV F +A++A++++ G L ++L V Sbjct: 218 LHTLFSQYGTVSSVVVMRDGMGR-SRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFV 274 Score = 33.1 bits (72), Expect = 0.18 Identities = 22/79 (27%), Positives = 40/79 (50%) Frame = +1 Query: 196 RWHGLVKSR*SYLPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEE 375 RW L S N+ RLR +F G++ + R S+GF FV F ++++ Sbjct: 302 RWSNLYVKNLSESMNET-RLREIFGCYGQIVSAKVMCHENGR-SKGFGFVCFSNCEESKQ 359 Query: 376 ALDTMDGRMLDGRELRVQM 432 A ++G ++DG+ + V++ Sbjct: 360 AKRYLNGFLVDGKPIVVRV 378 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 322 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +S+GF FV+F + A A + G M+ G++L V Sbjct: 149 QSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFV 183 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLD 408 VFE GE+ + + D+ T +++GF FV F R+ A+EAL R+L+ Sbjct: 123 VFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILN 171 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/49 (38%), Positives = 30/49 (61%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLD 408 VFE GE+ + + D+ T +++GF FV F R+ A+EAL R+L+ Sbjct: 123 VFEGYGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILN 171 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/60 (31%), Positives = 35/60 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L F+ G+V + D+ T S+ F F+ + + A+ A++TM+G L G++L+VQ+ Sbjct: 355 LAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQL 414 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 37.9 bits (84), Expect = 0.006 Identities = 19/60 (31%), Positives = 35/60 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L F+ G+V + D+ T S+ F F+ + + A+ A++TM+G L G++L+VQ+ Sbjct: 346 LAATFQPFGKVLSAKVFVDKATGISKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQL 405 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 37.5 bits (83), Expect = 0.008 Identities = 14/42 (33%), Positives = 29/42 (69%) Frame = +1 Query: 304 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +D+ T+ +GF F+ F DA++AL ++G++++GR + V+ Sbjct: 99 KDQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVE 140 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/67 (34%), Positives = 34/67 (50%) Frame = +1 Query: 232 LPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LP D R R V + + G + + G+AFV F + RDA++A+ DG DG Sbjct: 14 LPGDI-REREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGYDFDG 72 Query: 412 RELRVQM 432 LRV++ Sbjct: 73 HHLRVEL 79 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 37.5 bits (83), Expect = 0.008 Identities = 23/67 (34%), Positives = 34/67 (50%) Frame = +1 Query: 232 LPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 LP D R R V + + G + + G+AFV F + RDA++A+ DG DG Sbjct: 14 LPGDI-REREVEDLFSKYGPVVQIDLKIPPRPPGYAFVEFEDARDADDAIYGRDGYDFDG 72 Query: 412 RELRVQM 432 LRV++ Sbjct: 73 HHLRVEL 79 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM 402 L+ FE GE+ + + D+ T +G+ FV F R+ A EAL + RM Sbjct: 424 LKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRM 473 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 37.5 bits (83), Expect = 0.008 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+ F G++ D + DR + SRGF FV + A A+ M + LDGR + V Sbjct: 52 LKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGV 109 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL---DTMDGRMLDGRE 417 RLR F GEV + I +DR T +RGF FV F + AE + +DG++++ ++ Sbjct: 21 RLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLKHIIDGKIVEAKK 79 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL---DTMDGRMLDGRE 417 RLR F GEV + I +DR T +RGF FV F + AE + +DG++++ ++ Sbjct: 21 RLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLLKHIIDGKIVEAKK 79 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 F+ CG V + I D++ + +GFA+V F E +EAL + L GR+L+V Sbjct: 109 FQTCGTVNRVTILMDKFG-QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKV 160 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 F+ CG V + I D++ + +GFA+V F E +EAL + L GR+L+V Sbjct: 109 FQTCGTVNRVTILMDKFG-QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKV 160 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/49 (32%), Positives = 31/49 (63%) Frame = +1 Query: 277 GEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 423 GEV ++ I R++ + + +G+AFV F + A EA+DT++ G+ ++ Sbjct: 116 GEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIK 164 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL---DTMDGRMLDGRE 417 RL+ F GEV + I +DR T +RGF FV F + AE + +DGR+++ ++ Sbjct: 21 RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKK 79 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALD 384 FE+ G D+ + D T+ RGF F+ + D+EEA++ Sbjct: 128 FEQFGTTTDVVVMYDHNTQRPRGFGFITY----DSEEAVE 163 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 37.1 bits (82), Expect = 0.011 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL---DTMDGRMLDGRE 417 RL+ F GEV + I +DR T +RGF FV F + AE + +DGR+++ ++ Sbjct: 21 RLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKK 79 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALD 384 FE+ G D+ + D T+ RGF F+ + D+EEA++ Sbjct: 128 FEQFGTTTDVVVMYDHNTQRPRGFGFITY----DSEEAVE 163 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 + +F +CG V ++ I R + ++RGFAFV +A+ A+D D + GR + V Sbjct: 111 ISELFGQCGTVNNVEIIRQK-DGKNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISV 167 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/55 (36%), Positives = 32/55 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 +RR FE+ GE+ + I D+ T +S+G+ FV F E A A+ ++DGR+ Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAV-ADPNPVIDGRK 86 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/55 (36%), Positives = 32/55 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 +RR FE+ GE+ + I D+ T +S+G+ FV F E A A+ ++DGR+ Sbjct: 33 MRRYFEQFGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAV-ADPNPVIDGRK 86 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 F+ CG V + I D++ + +GFA+V F E +EAL + L GR+L+V Sbjct: 112 FQTCGTVHRVTILTDKFG-QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKV 163 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR+ F +CG + + D + S+GF FV F +A +A+ T G+M G+ L V Sbjct: 320 LRKHFSQCGTITSTKLMCDEKGK-SKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYV 376 Score = 34.7 bits (76), Expect = 0.058 Identities = 20/58 (34%), Positives = 29/58 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR F G++ + I +D R RG+AFV F DA A +T++G + L V Sbjct: 217 LREKFAEFGKIVSLAIAKDE-NRLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYV 273 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 L +VF G I RD + S+GF FV F DA A+D ++G+ D +E Sbjct: 240 LNKVFGEFGVTTSCVIMRDGEGK-SKGFGFVNFENSDDAARAVDALNGKTFDDKE 293 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/61 (31%), Positives = 30/61 (49%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +LR F G + + RD + SRG FV F +A A+ M+G+M+ + L V Sbjct: 342 KLREHFAPFGTITSCKVMRDP-SGVSRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVA 400 Query: 430 M 432 + Sbjct: 401 L 401 Score = 27.9 bits (59), Expect = 6.7 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +1 Query: 322 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +S+G+ FV++ A+ A+D ++G +L+ +++ V Sbjct: 171 QSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYV 205 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 36.3 bits (80), Expect = 0.019 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L+R+F GE+ + +D + SR F FV F + A A++ M+G ++D +EL V Sbjct: 135 LKRLFGEFGEITSAVVMKDGEGK-SRRFGFVNFEKAEAAVTAIEKMNGVVVDEKELHV 191 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 35.9 bits (79), Expect = 0.025 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 +R+VFE+ G V +I +P+D+ T E + F+++ + + A+ Sbjct: 126 IRQVFEKYGNVTEIILPKDKMTGERAAYCFIKYKKVEEGNAAI 168 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 + VF R G + DIY+ D + RG+AFV+F + A A+ ++G Sbjct: 223 VNEVFSRYGIIEDIYMALDDM-KICRGYAFVQFSCKEMALAAIKALNG 269 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 35.9 bits (79), Expect = 0.025 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM 402 L+ FE GE+ + + D+ T ++GF FV F R+ A AL + RM Sbjct: 179 LKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRM 228 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 35.5 bits (78), Expect = 0.033 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 L+ F V + + ++ T SRG+ FV F A A+ M+G+ L+G + V + Sbjct: 47 LKDAFSSFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISAMNGQELNGFNISVNV 106 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 35.5 bits (78), Expect = 0.033 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 LR V + G + ++ + R T SRG+ FV + ++ A + ++DGRE+ V Sbjct: 80 LREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSLIDGREIIV 137 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 35.5 bits (78), Expect = 0.033 Identities = 19/61 (31%), Positives = 32/61 (52%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +LR +F G + + RD + S+G FV F +A L+ M+G+M+ G+ L V Sbjct: 343 KLRELFAEFGTITSCKVMRDP-SGTSKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVA 401 Query: 430 M 432 + Sbjct: 402 L 402 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 35.5 bits (78), Expect = 0.033 Identities = 20/52 (38%), Positives = 29/52 (55%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 F + GEV D I DR T RGF FV F + AE+ L+ + ++D R++ Sbjct: 86 FGKFGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLE--EDHVIDDRKV 135 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 35.1 bits (77), Expect = 0.044 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +1 Query: 277 GEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 G V + DR T S+G+ FVRF + + A+ M+G+ R +R+ Sbjct: 179 GSVKGAKVVLDRTTGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRI 228 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 35.1 bits (77), Expect = 0.044 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +1 Query: 334 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 + FV F RDAE+A+ DG LDG LRV++ Sbjct: 47 YCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVEL 79 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 35.1 bits (77), Expect = 0.044 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +1 Query: 271 RCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 +CG V ++ + D TR +G AFV F + +A+ + G M R ++V+M Sbjct: 467 KCGAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAV-ALSGTMFYSRPIKVRM 519 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 35.1 bits (77), Expect = 0.044 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +1 Query: 331 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 G+AFV F + RDA++A+ DG DG LRV++ Sbjct: 46 GYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEI 79 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 34.7 bits (76), Expect = 0.058 Identities = 21/56 (37%), Positives = 31/56 (55%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +F G+V + +D + ESRGFAF+ F A A+ MDGR++ + L VQ Sbjct: 36 MFSDFGKVIRSVLAKD-FRGESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQ 90 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 34.7 bits (76), Expect = 0.058 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 328 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 R +AFV F + RDA++A +DGR DG + V+ Sbjct: 3 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVE 36 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 34.7 bits (76), Expect = 0.058 Identities = 18/55 (32%), Positives = 32/55 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 +RR F++ GE+ + I D+ T +S+G+ FV F + A A+ ++DGR+ Sbjct: 33 MRRYFDQFGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAV-ADPNPVIDGRK 86 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 34.3 bits (75), Expect = 0.077 Identities = 21/63 (33%), Positives = 30/63 (47%) Frame = +1 Query: 241 DA*RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 D +LR F GEV + RD+ T RGF FV F + + L + +D RE+ Sbjct: 18 DEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVL--QEKHSIDTREV 75 Query: 421 RVQ 429 V+ Sbjct: 76 DVK 78 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 34.3 bits (75), Expect = 0.077 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 271 RCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 + G V D++IPRD+ T + +GFAF + A+ A+ G Sbjct: 29 QAGRVIDLHIPRDKETDKPKGFAFAEYETEEIADYAVKLFSG 70 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 34.3 bits (75), Expect = 0.077 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 328 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 R +AFV F + RDA++A +DGR DG + V+ Sbjct: 3 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVE 36 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 34.3 bits (75), Expect = 0.077 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%) Frame = +1 Query: 232 LPNDA*RLRRVFERCGEVGDIYIPR---DRYTRESRGFAFVRFFERRDAEEALDTMDGRM 402 +P DA ++ E CGEVG + R DR T + +G+ F + + A A + Sbjct: 16 IPYDATE-EQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSYE 74 Query: 403 LDGRELRV 426 ++GR+LRV Sbjct: 75 INGRQLRV 82 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/59 (28%), Positives = 34/59 (57%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 LR++F+ G + ++ R T + FV F++ RDA A D M+G+ + G+++ ++ Sbjct: 229 LRQIFQVYGPIKEL-----RETPYKKHQRFVEFYDVRDAARAFDRMNGKEIGGKQVVIE 282 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 33.9 bits (74), Expect = 0.10 Identities = 18/54 (33%), Positives = 28/54 (51%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 LRR FE+ G+V D + + Y S+G+ F+ F + AL ++DGR Sbjct: 28 LRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQN-SKPIIDGR 80 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 L + F R + RD+ T +++G+ FV F D AL M+G+ + R ++++ Sbjct: 153 LSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSFLNPADLAAALKEMNGKYVGNRPIKLR 211 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 33.9 bits (74), Expect = 0.10 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 262 VFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 + E CG V D T++ +GF F F A+ + R +DG+EL V + Sbjct: 222 ILEFCGHVKSCLRAEDPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNV 278 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 33.9 bits (74), Expect = 0.10 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 L++ F R G V + + +++ T + RGF FVRF D +AL Sbjct: 22 LKQYFSRYGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL 64 Score = 30.7 bits (66), Expect = 0.95 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 FER G D+ + D T RGF FV + E + + + D R Sbjct: 140 FERFGRTTDVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKR 189 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 33.9 bits (74), Expect = 0.10 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 D T S+G+ FVRF + + A+ M+G R++RV Sbjct: 248 DSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRV 287 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 FER GE+ + D T+ S+GF FV F E A A + +DGR + ++ Sbjct: 29 FERFGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACEN-PNHTIDGRTVNCKL 83 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 33.5 bits (73), Expect = 0.13 Identities = 15/55 (27%), Positives = 31/55 (56%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 F + GE+ D I +DR T + RGF FV + + ++ + D ++ G+++ ++ Sbjct: 62 FGKYGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVI--QDNHIIIGKQVEIK 114 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 256 RRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRM-LDGRELRVQ 429 + F + GE+ + I RD T SRGF FV +E D + L R+ L G ++ ++ Sbjct: 147 KEFFMQFGELKEHQIMRDHSTGRSRGFGFVT-YESEDMVDHLLAKGNRIELSGTQVEIK 204 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 33.5 bits (73), Expect = 0.13 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 417 L+ F G++ + +D + S+GF FV F DA A+++++G D +E Sbjct: 45 LKNAFGEYGKITSAVVMKDGEGK-SKGFGFVNFENADDAARAVESLNGHKFDDKE 98 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +L+ +F G V + RD S+G FV F +A EA+ + G+M++ + L V Sbjct: 147 KLKEIFSPFGTVTSSKVMRDP-NGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYV 204 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 33.5 bits (73), Expect = 0.13 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 +R +FE+ G V DI + + R +RG F+ +A AL +++ +GR L+V Sbjct: 110 IRSLFEKYGSVIDIEMSMHKKER-NRGLVFIEMASPEEAATALKSLESCEYEGRRLKV 166 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 33.5 bits (73), Expect = 0.13 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 LR F GEV + + R++ T RGF FV F + + L D +D R++ V+ Sbjct: 22 LREYFSNFGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL--QDKHHIDNRDVDVK 78 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 298 IPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 423 + DR T S+G+ FVRF + + A+ M+G+ R +R Sbjct: 205 VVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMR 246 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +1 Query: 322 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 ++RGF V +++ R A++A + GR+L GR+L ++ Sbjct: 245 KNRGFIMVSYYDIRAAQKAARALHGRLLRGRKLDIR 280 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F GE+ ++ R T ++ FF+ R A+ AL ++G + GR+L++ Sbjct: 311 LHGIFSSYGEIREV-----RRTMHENSQVYIEFFDVRKAKVALQGLNGLEVAGRQLKL 363 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 32.3 bits (70), Expect = 0.31 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE----RRDAEEALDTMDGR 399 LR+ FE+ GE+ + + D+ T S+G+ FV F + RR + +DGR Sbjct: 40 LRQHFEQYGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGR 92 >At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing protein similar to Tat-SF1 - Homo sapiens, GI:1667611; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 519 Score = 31.9 bits (69), Expect = 0.41 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 328 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 +G VRF +RRDA++ ++ M+GR R++ + Sbjct: 454 QGVVLVRFKDRRDAQKCIEAMNGRWYAKRQIHASL 488 >At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 198 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 L+++F CGE+ D++IP R AF+ F A++AL ++G + G Sbjct: 43 LKKLFSPCGEITDVHIPETR-NSSLWSHAFIYFVGEGTADKALQ-LNGSDMGG 93 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 31.9 bits (69), Expect = 0.41 Identities = 21/89 (23%), Positives = 44/89 (49%) Frame = +1 Query: 160 IQNELRKTSATNRWHGLVKSR*SYLPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFA 339 + N T + + + +K+ + + N A L F G + + D R S+G+ Sbjct: 119 LSNRDPSTRLSGKGNVFIKNLDASIDNKA--LYETFSSFGTILSCKVAMDVVGR-SKGYG 175 Query: 340 FVRFFERRDAEEALDTMDGRMLDGRELRV 426 FV+F + A+ A+D ++G +L+ +++ V Sbjct: 176 FVQFEKEETAQAAIDKLNGMLLNDKQVFV 204 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 L++ F + G++ + +D+ + SR F FV F A A++ M+G Sbjct: 241 LKKTFGKYGDISSAVVMKDQ-SGNSRSFGFVNFVSPEAAAVAVEKMNG 287 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 +L+ +F G V + + SRGF FV + +A A+ M+G+M+ + L V Sbjct: 343 KLKEMFSEYGNVTSCKVMMNSQGL-SRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVA 401 Query: 430 M 432 + Sbjct: 402 L 402 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 31.9 bits (69), Expect = 0.41 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 LR FE+ G++ + + D+ + S+G+ FV F + A++A ++DGR Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKAC-VDPAPVIDGR 75 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 31.9 bits (69), Expect = 0.41 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 LR FE+ G++ + + D+ + S+G+ FV F + A++A ++DGR Sbjct: 23 LRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKAC-VDPAPVIDGR 75 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 31.9 bits (69), Expect = 0.41 Identities = 20/89 (22%), Positives = 44/89 (49%) Frame = +1 Query: 160 IQNELRKTSATNRWHGLVKSR*SYLPNDA*RLRRVFERCGEVGDIYIPRDRYTRESRGFA 339 + N T + + + +K+ + + N A L F G + + D T S+G+ Sbjct: 123 LSNRDPSTRLSGKGNIFIKNLDASIDNKA--LFETFSSFGTILSCKVAMD-VTGRSKGYG 179 Query: 340 FVRFFERRDAEEALDTMDGRMLDGRELRV 426 FV+F + A+ A+D ++G +++ +++ V Sbjct: 180 FVQFEKEESAQAAIDKLNGMLMNDKQVFV 208 Score = 31.1 bits (67), Expect = 0.72 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 7/97 (7%) Frame = +1 Query: 163 QNELRKTSATNRWHGLVKSR*S--YLPN-----DA*RLRRVFERCGEVGDIYIPRDRYTR 321 + ELR+ R + KS+ + YL N D +L+ +F G V + + Sbjct: 311 EEELRRKFEQERINRFEKSQGANLYLKNLDDSVDDEKLKEMFSEYGNVTSSKVMLNPQGM 370 Query: 322 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 SRGF FV + +A AL M+G+M+ + L + + Sbjct: 371 -SRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIAL 406 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 D T S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 234 DANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 273 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 D T S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 232 DANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 31.1 bits (67), Expect = 0.72 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 D T S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 232 DANTGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFE----RRDAEEALDTMDGR 399 LRR F++ G++ + + D+ T S+G+ FV F + RR + +DGR Sbjct: 40 LRRHFDQYGDILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGR 92 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 30.7 bits (66), Expect = 0.95 Identities = 19/47 (40%), Positives = 28/47 (59%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMD 393 L R+F++ G V DR +S G+AFV F + RDAE+A+ +D Sbjct: 18 LERLFDKYGRV-------DRVDMKS-GYAFVYFEDERDAEDAIRKLD 56 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEA 378 F+R GE+ + + DR T S+G+ FV F +DAE A Sbjct: 33 FKRFGEIIHVNVVCDRETDRSQGYGFVTF---KDAESA 67 >At3g14450.1 68416.m01831 RNA-binding protein, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (2 copies) Length = 327 Score = 30.3 bits (65), Expect = 1.3 Identities = 22/58 (37%), Positives = 31/58 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 L +F CG+V D I D ++ FAFV F + + A EAL ++ G ML +RV Sbjct: 157 LAGLFSNCGQVVDCRICGDPHS--VLRFAFVEFADDQGAHEAL-SLGGTMLGFYPVRV 211 >At1g73490.1 68414.m08508 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 259 Score = 30.3 bits (65), Expect = 1.3 Identities = 19/54 (35%), Positives = 31/54 (57%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 F CG+V IY+P T S G+AF+ + ++ + L T++G L GR++ V Sbjct: 141 FSSCGKVYLIYVPIACSTGASVGYAFI---DMKNETKGL-TLNGSHLGGRKIDV 190 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAE----EALDTMDGR 399 +++ FE+ GE+ + + D+ + S+G+ FV F E A +A +DGR Sbjct: 29 MKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAE----EALDTMDGR 399 +++ FE+ GE+ + + D+ + S+G+ FV F E A +A +DGR Sbjct: 29 MKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAE----EALDTMDGR 399 +++ FE+ GE+ + + D+ + S+G+ FV F E A +A +DGR Sbjct: 29 MKKHFEQFGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGR 81 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 DR T ++G+ FVRF + + A+ M+G R +R+ Sbjct: 190 DRVTGRTKGYGFVRFSDESEQIRAMTEMNGVPCSTRPMRI 229 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 30.3 bits (65), Expect = 1.3 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 DR T ++G+ FVRF + + A+ M+G R +R+ Sbjct: 190 DRVTGRTKGYGFVRFSDESEQIRAMTEMNGVPCSTRPMRI 229 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 307 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 426 D T S+G+ FV+F E + A+ M+G R +R+ Sbjct: 151 DPSTGRSKGYGFVKFAEESERNRAMAEMNGLYCSTRPMRI 190 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 29.9 bits (64), Expect = 1.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 L + F+ CGE+ +Y+P D + AF+R E AE+ + G Sbjct: 133 LEKHFDSCGEIRHVYVPTDYERGVLKSVAFLR-IEGEGAEDKALQLSG 179 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 L + F CGE+ IY+PRD + + +F+ + + AE+ + G + G Sbjct: 44 LTKHFASCGEITQIYVPRDFKKKILKSVSFM-WIKGEGAEDKALQLSGTDVGG 95 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 328 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 R +AFV F DA A++++ G L G LR++ Sbjct: 58 RSYAFVNFNHDEDAFAAIESLQGFPLSGNPLRIE 91 >At1g63610.2 68414.m07192 expressed protein Length = 341 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 394 RPSCPGLLQHHDARKTLRRRILYFPLCTDLWEC 296 RP CP L +H+ + + + FPL T+ W+C Sbjct: 17 RP-CPSFLANHEPKLSTTSSSVTFPLKTNTWKC 48 >At1g63610.1 68414.m07191 expressed protein Length = 340 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 394 RPSCPGLLQHHDARKTLRRRILYFPLCTDLWEC 296 RP CP L +H+ + + + FPL T+ W+C Sbjct: 17 RP-CPSFLANHEPKLSTTSSSVTFPLKTNTWKC 48 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 29.9 bits (64), Expect = 1.7 Identities = 12/51 (23%), Positives = 28/51 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRML 405 + F GE+ ++ + DR + +G+A + + ++ +A+ A+ M+G L Sbjct: 111 ITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISAMNGAEL 161 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 331 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQ 429 GFAFV + RDAE+A+ +D GR GR LRV+ Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVE 70 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 331 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQ 429 GFAFV + RDAE+A+ +D GR GR LRV+ Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVE 70 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 331 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQ 429 GFAFV + RDAE+A+ +D GR GR LRV+ Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEFGR--KGRRLRVE 70 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 319 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 408 R R FAFV+F + DA +ALD T + ++LD Sbjct: 100 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 130 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 319 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 408 R R FAFV+F + DA +ALD T + ++LD Sbjct: 126 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 156 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 265 FERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 F++ GE+ D D+ + +S+G+ F+ F R A AL Sbjct: 148 FKQYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNAL 186 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 ++ +F G++ I DR R S+G A V F R DA A+ + LDG+ +++++ Sbjct: 124 IKELFSEVGDLKRYGIHYDRSGR-SKGTAEVVFSRRGDALAAVKRYNNVQLDGKLMKIEI 182 >At3g45850.1 68416.m04962 kinesin motor protein-related kinesin-related protein TKRP125, Nicotiana tabacum, PIR:T02017 Length = 1058 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +1 Query: 250 RLRRVFERCGEVGDIYIPRDRYTR-ESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 420 RL++ E IYIP+DRY + E+ A ER + + ++ D R++D +EL Sbjct: 415 RLKQEVYAAREKNGIYIPKDRYIQEEAEKKAMAEKIERLELQS--ESKDKRVVDLQEL 470 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 ++ +F GE+ + DR R S+G A V + R DA A+ + LDG+ +++++ Sbjct: 102 IKELFAEVGELKRYTVHFDRSGR-SKGTAEVVYSRRGDALAAVKKYNDVQLDGKPMKIEI 160 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 ++ +F GE+ + DR R S+G A V + R DA A+ + LDG+ +++++ Sbjct: 38 IKELFAEVGELKRYTVHFDRSGR-SKGTAEVVYSRRGDALAAVKKYNDVQLDGKPMKIEI 96 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/60 (28%), Positives = 32/60 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 432 ++ +F GE+ + DR R S+G A V + R DA A+ + LDG+ +++++ Sbjct: 104 IKELFAEVGELKRYTVHFDRSGR-SKGTAEVVYSRRGDALAAVKKYNDVQLDGKPMKIEI 162 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 304 RDRYTRESRGFAFVRFFERRDAEEALDTMDG 396 RD Y R+SRG FV++ + A A+D ++G Sbjct: 2 RDEY-RQSRGCGFVKYSSKETAMAAIDGLNG 31 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 319 RESRGFAFVRFFERRDAEEALDTMDGR 399 R G+AF+ F + RDA +A+ +DG+ Sbjct: 35 RRPPGYAFLDFEDPRDARDAIRALDGK 61 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 L F++ GE+ D D+ + +S+G+ F+ + R A AL Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNAL 198 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 L F++ GE+ D D+ + +S+G+ F+ + R A AL Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNAL 198 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEAL 381 L F++ GE+ D D+ + +S+G+ F+ + R A AL Sbjct: 156 LIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNAL 198 >At5g53700.1 68418.m06672 hypothetical protein Length = 248 Score = 27.9 bits (59), Expect = 6.7 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALD 384 L + F CG++ DI +PRD R + F+ F ++ E +D Sbjct: 38 LAKHFASCGKIVDIDVPRDFKKRILKSPLFI-IFHAKEGESPVD 80 >At4g08750.1 68417.m01443 RNA recognition motif (RRM)-containing protein contains Pfam domain PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 461 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 429 L + F CGE+ +++PR+ T +GF A++AL+ + G + G+EL V+ Sbjct: 364 LSKHFSVCGEITRVFVPRNPSTGAIKGF---------KAKKALE-LSGSKMTGKELVVK 412 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 268 ERCGEVGDIYIPRDRYT-RESRGFAFVRFFERRDAEEALDTMDGRMLDG 411 E G GDI DR T SRGFAF+ + +A A + + G L+G Sbjct: 36 ELFGRYGDI----DRITVYSSRGFAFIYYRHVEEAVAAKEALQGANLNG 80 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 27.9 bits (59), Expect = 6.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 319 RESRGFAFVRFFERRDAEEALDTMDGR 399 R G+AF+ F + RDA +A+ +DG+ Sbjct: 35 RRPPGYAFLDFEDSRDARDAIREVDGK 61 >At2g31920.1 68415.m03899 expressed protein Length = 585 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = -3 Query: 537 CGYDCASNYEAGTRPGPAPAIVTTPVWR*GATISRHLNAKFPAVQHSSVHRVQGFFSITT 358 CG A + +PG ++ ++P + IS+HLN + PA++ V + S+T Sbjct: 209 CGTSPALRNKNVVKPGSPISMASSPKDGIKSPISKHLNCETPALRSRYVVKPASPISVTR 268 Query: 357 LEK 349 K Sbjct: 269 SPK 271 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 27.5 bits (58), Expect = 8.8 Identities = 13/54 (24%), Positives = 28/54 (51%) Frame = +1 Query: 253 LRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 414 + V + G V +I +R + +S+G+ V F++ A + M+G + +G+ Sbjct: 218 IESVLSQYGRVKEIKFFDERVSGKSKGYCQVEFYDSAAAAACKEGMNGFIFNGK 271 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,692,714 Number of Sequences: 28952 Number of extensions: 243150 Number of successful extensions: 829 Number of sequences better than 10.0: 193 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 827 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -