Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060463.seq
         (671 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.            29   0.10 

>AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein.
          Length = 1152

 Score = 29.5 bits (63), Expect = 0.10
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = -1

Query: 224 EKTLHC-CTSYSFVQYFENMLTTVSRTTIALV 132
           +  LHC C +Y+F QY +N L T       LV
Sbjct: 597 DNPLHCNCIAYAFAQYIQNRLATAVYDRFELV 628


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 629,315
Number of Sequences: 2352
Number of extensions: 11416
Number of successful extensions: 59
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 59
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 67322955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)