BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060460.seq (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 0.67 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 4.7 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 4.7 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 4.7 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 8.2 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 25.0 bits (52), Expect = 0.67 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 613 NWLAKFWVQNWGW 651 NWL+ FW W W Sbjct: 163 NWLSVFWGSAWQW 175 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 307 LYNFFRSVFFRIEH 266 +Y+FF+ FRI+H Sbjct: 337 IYDFFKDSSFRIQH 350 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 4.7 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 61 IHENKLS-T*VTQNLI*RLK*DSILIGISCFLY*NS*QQRRHMTSQSS 201 +HE + T + QN+I +K D +L +LY N+ T S+ Sbjct: 348 VHEKQQEITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSA 395 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 4.7 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +1 Query: 61 IHENKLS-T*VTQNLI*RLK*DSILIGISCFLY*NS*QQRRHMTSQSS 201 +HE + T + QN+I +K D +L +LY N+ T S+ Sbjct: 386 VHEKQQEITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSA 433 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 545 YLYFWSTGDVAN*QELFVGSLG 610 +L+ W D+A E F+G +G Sbjct: 35 HLFEWKWNDIAKECEQFLGPVG 56 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,963 Number of Sequences: 438 Number of extensions: 3869 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -