BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060459.seq (684 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 9.4 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.4 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 21 9.4 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 9.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 9.4 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 87 LSGQRIKTRKRDEKEKYDPNGFRD 158 +SG + EKYDP F D Sbjct: 393 ISGLHYDPEYYPDPEKYDPERFSD 416 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 99 RIKTRKRDEKEKY 137 R K ++RDE+E+Y Sbjct: 403 RHKQKRRDERERY 415 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -3 Query: 343 VGLGRFAVHRH 311 VG+G+F VHR+ Sbjct: 88 VGIGQFLVHRN 98 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -1 Query: 291 RPPAMSTSNMTSHSVGSRVLIRPSLGTCRLRRDRHRPAPDXV 166 R + M+S+ SRV++ P L ++ P P + Sbjct: 117 RNSTLRRQQMSSYYNESRVMMSPPGNVLNLTMPKYEPNPSII 158 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/42 (23%), Positives = 18/42 (42%) Frame = -1 Query: 291 RPPAMSTSNMTSHSVGSRVLIRPSLGTCRLRRDRHRPAPDXV 166 R + M+S+ SRV++ P L ++ P P + Sbjct: 117 RNSTLRRQQMSSYYNESRVMMSPPGNVLNLTMPKYEPNPSII 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,913 Number of Sequences: 336 Number of extensions: 3683 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -