BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060458.seq (681 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 42 6e-04 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 41 8e-04 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 40 0.001 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 40 0.002 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 39 0.004 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 38 0.010 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.017 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 36 0.023 SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) 36 0.023 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 36 0.030 SB_732| Best HMM Match : AAA (HMM E-Value=0) 36 0.030 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 36 0.040 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) 35 0.053 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.053 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 34 0.093 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) 33 0.28 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 32 0.37 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 32 0.37 SB_58530| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) 32 0.49 SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 31 1.1 SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) 30 1.5 SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) 30 2.0 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 29 3.5 SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) 29 3.5 SB_42542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) 29 3.5 SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 29 4.6 SB_56370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_3185| Best HMM Match : Sec63 (HMM E-Value=0) 29 4.6 SB_56551| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=0.0049) 28 6.1 SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_58257| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 28 8.0 SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) 28 8.0 SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) 28 8.0 SB_16789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 28 8.0 SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_21493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 89.0 bits (211), Expect = 3e-18 Identities = 56/132 (42%), Positives = 78/132 (59%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLME 433 +I+ K+AGRA+L+AG PGTGKTAIA+ +AQ LG PF + GSE++S E+ KTE L + Sbjct: 161 MIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMSKTEALTQ 220 Query: 434 NFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLDP 613 + L + ET E+ EGEV E+ + + G G V + LKT + L Sbjct: 221 ---PSESLLVEET-EIIEGEVVEVQIDRP---TTGTGAKVGK--LTLKTTEMETIYDLGT 271 Query: 614 TIYESLPKEKVE 649 + ESL KEKV+ Sbjct: 272 KMIESLTKEKVQ 283 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/38 (55%), Positives = 30/38 (78%) Frame = +3 Query: 141 AHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVD 254 AHSHI+GLGLD+ Q++ G+VGQ +AR AAGI+++ Sbjct: 123 AHSHIRGLGLDDALEARQVSQGMVGQVTARRAAGIILE 160 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/37 (54%), Positives = 26/37 (70%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + +L+GPPGTGKT +A A+A E G VPF + GSE Sbjct: 82 KGAILSGPPGTGKTLLAKAVAGEAG--VPFLSISGSE 116 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 41.1 bits (92), Expect = 8e-04 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LMENFRRA 448 R +LL GP GTGKT IA A+A E G FC + G EV S +TE L E F A Sbjct: 291 RGILLYGPSGTGKTMIARAVANETGVHF-FC-INGPEVLSRYYGETEARLREIFTEA 345 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + LL GPPGTGKT +A A+A E VPF M GS+ Sbjct: 159 KGALLVGPPGTGKTLLAKAVATE--ADVPFLSMAGSD 193 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 40.3 bits (90), Expect = 0.001 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 448 +LLAGPPG GKT +A AIA E G + F + G E+ + + ++E + + F+RA Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPELLNMYVGESERAVRQVFQRA 72 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 39.9 bits (89), Expect = 0.002 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 2/75 (2%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGS--EVYSTEIKKTEVLMENFRRAIGLR 460 ++L GPPG+GKT +A I + + P + S + + TE++KTE E +R ++ Sbjct: 1252 IILRGPPGSGKTHVAKLIKDKEVSSGAHAPRILSLDDYFLTEVEKTEKDPETGKR---IK 1308 Query: 461 IRETKEVYEGEVTEL 505 + T+ VYE E+ E+ Sbjct: 1309 KKVTEYVYEPEMEEV 1323 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 R +L+ GPPGTGKT +A A+A E GT Sbjct: 284 RGVLMVGPPGTGKTMLAKAVATECGT 309 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 38.7 bits (86), Expect = 0.004 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 448 LLL GPPGTGKT +A +A+E G + F + G E+ S I +E + + F RA Sbjct: 704 LLLYGPPGTGKTLLAGVVAKECG--LNFISIKGPELLSKYIGASEQAVRDMFTRA 756 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS-TEIKKTEVLMENFRRAI 451 LL GPPG GKT +A AIA EL ++PF + +E+ S + E + E F A+ Sbjct: 714 LLHGPPGCGKTLLAHAIAGEL--EMPFLKLAATEIVSGVSGESEEKVRELFTSAV 766 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/36 (52%), Positives = 24/36 (66%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 +LLAGPPG GKT +A AIA E G + F + G E+ Sbjct: 20 ILLAGPPGCGKTLLAKAIANESG--INFISVKGPEL 53 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Frame = +2 Query: 266 KKMAGR---ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 K++ G+ +LL G PGTGKT +A A+A E G VPF GSE Sbjct: 157 KRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAG--VPFFFCSGSE 199 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 36.3 bits (80), Expect = 0.023 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +LL GPPG GKT +A A+A T F +VGSE Sbjct: 199 RGVLLYGPPGCGKTMLAKAVAHH--TTAAFIRVVGSE 233 >SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) Length = 568 Score = 36.3 bits (80), Expect = 0.023 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + QELG Sbjct: 272 KAALLSGPPGVGKTTTATLVCQELG 296 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 35.9 bits (79), Expect = 0.030 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG---TKVPFCPMVGSEVYSTEIKKTE 421 R +L GPPGTGKT +A A+A E KV F G++ S + ++E Sbjct: 919 RGVLFFGPPGTGKTLVARALANECSQGDKKVSFFMRKGADCLSKWVGESE 968 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 35.9 bits (79), Expect = 0.030 Identities = 24/80 (30%), Positives = 37/80 (46%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLR 460 + +LL GPPGTGKT +A I L T+ P + G EV + + ++E N R+ Sbjct: 183 KGILLFGPPGTGKTLMARQIGTMLNTREPKI-ISGPEVLNKFVGESEA---NIRKLFAEA 238 Query: 461 IRETKEVYEGEVTELTLLKQ 520 E K + L + + Sbjct: 239 EEEQKRFGDNSALHLIIFDE 258 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 35.9 bits (79), Expect = 0.030 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 212 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 247 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 35.5 bits (78), Expect = 0.040 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT A A+A T F ++GSE+ Sbjct: 119 KGVLLFGPPGTGKTLCARAVANR--TDACFIRVIGSEL 154 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 35.5 bits (78), Expect = 0.040 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LMENFRRA 448 +LL GPPGTGKT +A A+A E + F + G E+ + + ++E + E F RA Sbjct: 847 VLLYGPPGTGKTLMAKAVATE--CSLNFLSVKGPELINMYVGQSEQNVREVFSRA 899 >SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) Length = 230 Score = 35.1 bits (77), Expect = 0.053 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMV 382 LL GPPGTGKT+ LA+A++L F MV Sbjct: 13 LLFYGPPGTGKTSTILAVAKQLYPDKQFGSMV 44 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 35.1 bits (77), Expect = 0.053 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + ++L G PGTGKT +A A+A + T F +VGSE+ Sbjct: 415 KGVILYGQPGTGKTLLAKAVANQ--TSATFLRVVGSEL 450 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 34.3 bits (75), Expect = 0.093 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 260 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 R+K M R LL GPPGTGKT A ++A+ G + + M G +V Sbjct: 324 RNKGMY-RNLLFYGPPGTGKTMFAKSLARHSG--MDYAVMTGGDV 365 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTK 361 L+ + A R +LL GP GTGKT++A + Q+L K Sbjct: 1746 LVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPK 1781 >SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKV 364 + LL GPPG GKT +A IAQ G V Sbjct: 381 KVALLCGPPGLGKTTLAHVIAQHAGYNV 408 >SB_8110| Best HMM Match : AAA (HMM E-Value=0.0032) Length = 1199 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +2 Query: 284 ALLLAGPPGTGKTAIALAIAQELGTKV 364 A+L+ GP G GKTA A A ELG KV Sbjct: 640 AMLVVGPRGAGKTASIYACAGELGYKV 666 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 32.3 bits (70), Expect = 0.37 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 6/109 (5%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTK-VPFCPMVGSEVY----STEIKKTEVLMENFRRAI 451 +LL GPPG GKT + + Q L ++ VP E+ + V ++ R + Sbjct: 54 VLLTGPPGIGKTTLCSKVKQALASRGVPTQGFYTEEIRGPGGGARVGFDVVTLDGGRGPL 113 Query: 452 GLRIRETKEVYEG-EVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTK 595 R++ + +EG V +LL+Q G + +S V G ++ K Sbjct: 114 A-RVKTLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 161 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 32.3 bits (70), Expect = 0.37 Identities = 15/39 (38%), Positives = 27/39 (69%) Frame = +2 Query: 239 RDSCRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELG 355 +++ R++R+ ++ R +LL G PG GKT++ AIA+ G Sbjct: 1605 QNATRILRALQLP-RPILLEGSPGVGKTSLVSAIAKASG 1642 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTKVP 367 AG +LL GP G+GKT + +A G P Sbjct: 117 AGSGVLLEGPVGSGKTCLVEHVASMCGRSTP 147 >SB_58530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 31.9 bits (69), Expect = 0.49 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 2/104 (1%) Frame = +2 Query: 236 CRDSCRLIRSKKMAG-RALLLAGPPGTGKTAIALAIAQELG-TKVPFCPMVGSEVYSTEI 409 C D + K + R + + G PG+GKT +A +A+ G T + ++ E Sbjct: 89 CDDEIAKTKGKGLLNARVIFVIGGPGSGKTELAKLLAESSGRTHISMGQLLKEEATKDTD 148 Query: 410 KKTEVLMENFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGY 541 + EV RAIG+ + E G ++E + +K L GGY Sbjct: 149 RAREV-----ARAIGMGTLVSPEHALGILSETIVRGEKNL-GGY 186 >SB_34097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 31.9 bits (69), Expect = 0.49 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 284 ALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 A+L+ GP G GKTA A A ELG K C S+ Sbjct: 30 AMLVVGPRGAGKTASIYACAGELGYKDVECDTDASQ 65 >SB_5068| Best HMM Match : DED (HMM E-Value=1.5e-17) Length = 786 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +2 Query: 233 GCRDSCRLIRSKKMAG--RALLLAGPPGTGKTAIALAIAQEL 352 G C+ + +K G + + + GPPG GK+ +A+ +A EL Sbjct: 110 GRESECQAVFTKLTTGPCQIVTITGPPGFGKSCVAIHVAHEL 151 >SB_58982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 838 Score = 31.1 bits (67), Expect = 0.86 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Frame = +2 Query: 293 LAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTE----IKKTEVLMENFRRAI 451 + GP G+GKTA+ LA+ + L C +V +++++ E + K + L E RA+ Sbjct: 28 IGGPVGSGKTALVLALCKYLRDSCNIC-VVTNDIFTKEDWEFLVKNKALDEKRMRAV 83 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 + +L GPPG GKT +A AIA E Sbjct: 345 KGVLFYGPPGCGKTLLAKAIANE 367 >SB_216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI 409 + + +++ GP G GKTA+ +AI +E+ K + G+ + +I Sbjct: 506 SNQVVMVTGPVGCGKTALLMAILKEIPLKQGSVTLCGTVAFVDQI 550 >SB_47632| Best HMM Match : AAA_5 (HMM E-Value=0.00038) Length = 1172 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +2 Query: 248 CRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQEL-GTKVPFCPMVGSEVYSTEIKKTEV 424 C ++R++ ++++AGPPGTGK++ A+ + L GS +++ +++K V Sbjct: 1091 CTVVRNRT----SIIVAGPPGTGKSSCISALIETLTECSATKHKNTGSPMHTHKLQKAIV 1146 Query: 425 LME 433 M+ Sbjct: 1147 YMD 1149 >SB_48651| Best HMM Match : ABC_tran (HMM E-Value=2.1e-24) Length = 569 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTE 406 LI + G L + GP G GK+++ +AI EL + G YS++ Sbjct: 147 LIDNSYFKGELLAIVGPVGAGKSSLLMAILGELPFTEGTITVKGKIAYSSQ 197 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQEL 352 ++ GPPGTGKT I L +A+ L Sbjct: 875 VIQGPPGTGKTYIGLKVAKVL 895 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQEL 352 R LL GPPG GK++ A+A EL Sbjct: 223 RGYLLYGPPGCGKSSFIQALAGEL 246 >SB_25516| Best HMM Match : AAA_2 (HMM E-Value=0) Length = 609 Score = 29.1 bits (62), Expect = 3.5 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +2 Query: 239 RDSCRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFC 373 +DS RL +S +LL GP G+GKT +A IA+ L C Sbjct: 263 QDSIRLDKSN------ILLLGPTGSGKTLLAQTIARCLDVPFAIC 301 >SB_42542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 574 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/76 (25%), Positives = 36/76 (47%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 R I+ K + +++ GP G GK+++ L+I E+ + G Y +I + + Sbjct: 174 RGIKLKAVCDDLVIITGPVGGGKSSLLLSILGEIPLISGSISVRGRIAYFPQIPFGKQME 233 Query: 431 ENFRRAIGLRIRETKE 478 E R IG I + ++ Sbjct: 234 EESREKIGQDISQRED 249 >SB_42068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3367 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 242 DSCRLIRSKKMAGR-ALLLAGPPGTGKTAIALAIAQELG 355 D C L ++ + GR GP GTGKT A+ Q+LG Sbjct: 1835 DRCYLTMTQALEGRLGGSPFGPAGTGKTESVKALGQQLG 1873 >SB_17427| Best HMM Match : ResIII (HMM E-Value=0.6) Length = 486 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +2 Query: 266 KKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPM 379 KK G +L ++G PGTGKTA + +++ +V CP+ Sbjct: 232 KKKPG-SLYISGAPGTGKTACLTMVIRDM-KEVSDCPV 267 >SB_58373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.7 bits (61), Expect = 4.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTK 361 +L+ G PGTGK+ + +A LG K Sbjct: 11 ILITGTPGTGKSTTGVELANRLGFK 35 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 293 LAGPPGTGKTAIALAIAQEL 352 L GPPGTGKT L +A+ L Sbjct: 869 LEGPPGTGKTTSILCLARAL 888 >SB_56370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +1 Query: 505 NTVETENPGWRLWKNSISCDHRTKNGQ 585 N +E ++P W+LWK+ ++ H T +G+ Sbjct: 117 NDIEGDDP-WQLWKDMVTSRHLTPSGK 142 >SB_3185| Best HMM Match : Sec63 (HMM E-Value=0) Length = 2590 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +2 Query: 239 RDSCRLIRSKKMAGRALLLAGPPGTGKTAIA-LAIAQELGTKVPFCPMVGSEVY 397 R RL + + LLL P G GKT +A L I +E+G + + +E + Sbjct: 1115 RIQSRLCETALNSDENLLLCAPTGAGKTNVALLTILREIGKHINLDGTINTEEF 1168 >SB_56551| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=0.0049) Length = 113 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 Query: 167 PQAFYMTVSRDPLRFSCAFHFFNFHVESSFTLLN 66 P YM R P R F+FF F + + T LN Sbjct: 4 PSKAYMQTRRFPKRHISIFNFFTFSCKQAVTFLN 37 >SB_46433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 269 KMAGRALL-LAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI 409 K+ G L+ + GP G+GK+++ LAI E+ + G VY ++ Sbjct: 270 KLKGSRLIGITGPCGSGKSSLLLAILNEMSLISGEAVVQGETVYVPQV 317 >SB_16306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 958 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 239 RDSCRLIRSKKMAGRALLLAGPPGTGKTAIALAIA 343 R+ + I K G L L GP G+GKT + +A Sbjct: 22 REILKTINGKVRPGEMLALMGPSGSGKTTLLNVLA 56 >SB_58257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 488 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 269 SYFLSIYNYPCSLTCRLLTHETGCHLNR 186 SY LSI+ Y +LL H+ GC ++R Sbjct: 216 SYPLSIFGYSRQTQRKLLRHKRGCRVHR 243 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVG 385 ++L GP G GK+++ +AI E+ K F +G Sbjct: 589 VILTGPVGGGKSSLLMAILGEIPLKRGFIKAIG 621 >SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) Length = 514 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 272 MAGRALLLAGPPGTGKTAIALAIAQEL 352 ++ R ++ GPPG GKT + + I Q L Sbjct: 388 LSNRLAIVQGPPGCGKTFLGVKIVQLL 414 >SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1310 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +2 Query: 242 DSCRL--IRSKKMAGRALLLAGPPGTGKTAIALAIAQEL 352 DSC L + AG +++ GP G+GK+ + + I EL Sbjct: 471 DSCTLQGVSFAAGAGDLVIITGPVGSGKSTLLMTIQGEL 509 >SB_16789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 518 QKILAGGYGKTVSHVIIGLKTAKGTKQLKLDPTIYE 625 + ++A GY S +I L T G + LDP+I E Sbjct: 154 RNMVAAGYALYGSATVIVLSTGNGVNEFTLDPSIGE 189 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQEL 352 +++AGPPGTGK++ A+ + L Sbjct: 2 IIVAGPPGTGKSSCISALIETL 23 >SB_12904| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 27.9 bits (59), Expect = 8.0 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 166 GWMKMVFLFKWQPVSWV 216 G++K FLF+++P SWV Sbjct: 9 GYIKAYFLFEYEPTSWV 25 >SB_3314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 663 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 293 LAGPPGTGKTAIALAIAQELGTKVP 367 + GPPGTGKT +A+ I + P Sbjct: 590 VVGPPGTGKTDVAVQIISNIYHNFP 614 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,328,309 Number of Sequences: 59808 Number of extensions: 436836 Number of successful extensions: 1364 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1363 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -