BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060458.seq (681 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061095-1|AAL28643.1| 456|Drosophila melanogaster LD08555p pro... 231 9e-61 AE014297-1128|AAF54514.1| 456|Drosophila melanogaster CG4003-PA... 231 9e-61 AF233278-1|AAF43411.1| 456|Drosophila melanogaster pontin protein. 227 8e-60 AY061155-1|AAL28703.1| 481|Drosophila melanogaster LD12420p pro... 113 2e-25 AY060952-1|AAL28500.1| 481|Drosophila melanogaster GM08688p pro... 113 2e-25 AF233279-1|AAF43412.1| 481|Drosophila melanogaster reptin protein. 113 2e-25 AE014296-3115|AAF49182.1| 481|Drosophila melanogaster CG9750-PA... 113 2e-25 AF145606-1|AAD38581.1| 442|Drosophila melanogaster BcDNA.GH0267... 41 0.001 AE014298-2640|AAF48783.1| 442|Drosophila melanogaster CG6842-PA... 41 0.001 AY118458-1|AAM49827.1| 504|Drosophila melanogaster GH01006p pro... 40 0.002 AL023874-1|CAA19646.1| 819|Drosophila melanogaster EG:100G10.7 ... 40 0.002 AE014298-443|AAS65257.1| 504|Drosophila melanogaster CG2658-PB,... 40 0.002 AE014298-442|AAF45806.1| 819|Drosophila melanogaster CG2658-PA,... 40 0.002 AY051480-1|AAK92904.1| 736|Drosophila melanogaster GH14313p pro... 40 0.003 AE013599-3496|AAM71132.2| 736|Drosophila melanogaster CG3499-PB... 40 0.003 BT023721-1|AAY85121.1| 673|Drosophila melanogaster AT01259p pro... 39 0.006 BT001274-1|AAN71030.1| 669|Drosophila melanogaster AT05655p pro... 39 0.006 AY051591-1|AAK93015.1| 605|Drosophila melanogaster GH23455p pro... 39 0.006 AE014297-353|AAF51954.1| 669|Drosophila melanogaster CG1193-PB,... 39 0.006 AE014297-352|AAF51955.2| 605|Drosophila melanogaster CG1193-PA,... 39 0.006 AY058375-1|AAL13604.1| 897|Drosophila melanogaster GH14288p pro... 39 0.007 AE013599-1191|AAF58736.3| 897|Drosophila melanogaster CG11919-P... 39 0.007 U39303-1|AAB34134.1| 439|Drosophila melanogaster P26s4 protein. 38 0.010 AY058759-1|AAL13988.1| 439|Drosophila melanogaster SD02658p pro... 38 0.010 AF202034-1|AAF17568.1| 799|Drosophila melanogaster endoplasmic ... 38 0.010 AF132553-1|AAD27852.1| 801|Drosophila melanogaster BcDNA.GM0288... 38 0.010 AF047037-1|AAC27447.1| 801|Drosophila melanogaster transitional... 38 0.010 AE014297-3409|AAF56205.1| 439|Drosophila melanogaster CG5289-PA... 38 0.010 AE013599-984|AAF58863.1| 801|Drosophila melanogaster CG2331-PA,... 38 0.010 X99207-1|CAA67594.1| 943|Drosophila melanogaster smallminded pr... 38 0.013 AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p pro... 38 0.013 AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA... 38 0.013 AE014296-1253|AAS65065.1| 850|Drosophila melanogaster CG8571-PB... 38 0.013 AE014296-1252|AAF50566.1| 944|Drosophila melanogaster CG8571-PA... 38 0.013 AY084199-1|AAL89937.1| 826|Drosophila melanogaster SD01613p pro... 38 0.017 AY075495-1|AAL68305.1| 501|Drosophila melanogaster RE47719p pro... 38 0.017 AE014296-2879|AAN11704.1| 697|Drosophila melanogaster CG6512-PB... 38 0.017 AE014296-2878|AAF49365.2| 826|Drosophila melanogaster CG6512-PA... 38 0.017 AY094800-1|AAM11153.1| 421|Drosophila melanogaster LD24646p pro... 37 0.029 AE014297-764|AAN13388.1| 421|Drosophila melanogaster CG31453-PA... 37 0.029 BT016035-1|AAV36920.1| 405|Drosophila melanogaster RE01104p pro... 36 0.039 AY113319-1|AAM29324.1| 270|Drosophila melanogaster AT28212p pro... 36 0.039 AE014297-1026|AAF54440.1| 421|Drosophila melanogaster CG9475-PA... 36 0.039 AE014297-1025|AAN13443.2| 389|Drosophila melanogaster CG9475-PB... 36 0.039 U97538-1|AAC48284.1| 405|Drosophila melanogaster DUG protein. 36 0.051 AY119229-1|AAM51089.1| 399|Drosophila melanogaster SD17676p pro... 36 0.051 AY051732-1|AAK93156.1| 405|Drosophila melanogaster LD26005p pro... 36 0.051 AF043734-1|AAC63219.1| 405|Drosophila melanogaster Pros45 prote... 36 0.051 AE014298-3108|AAF50835.1| 405|Drosophila melanogaster CG1489-PA... 36 0.051 AE014297-4633|AAF57069.1| 399|Drosophila melanogaster CG2241-PA... 36 0.051 AY113316-1|AAM29321.1| 384|Drosophila melanogaster AT28104p pro... 36 0.068 AY089357-1|AAL90095.1| 479|Drosophila melanogaster AT18413p pro... 36 0.068 AY071182-1|AAL48804.1| 397|Drosophila melanogaster RE23388p pro... 36 0.068 AY061606-1|AAL29154.1| 433|Drosophila melanogaster SD07148p pro... 36 0.068 AF145310-1|AAF08391.1| 390|Drosophila melanogaster 26S proteaso... 36 0.068 AF145307-1|AAF08388.1| 433|Drosophila melanogaster 26S proteaso... 36 0.068 AF145306-1|AAF08387.1| 413|Drosophila melanogaster 26S proteaso... 36 0.068 AE014298-1555|AAF48001.1| 413|Drosophila melanogaster CG16916-P... 36 0.068 AE014298-869|AAF46146.2| 390|Drosophila melanogaster CG3455-PA ... 36 0.068 AE014298-515|AAF45864.1| 479|Drosophila melanogaster CG10793-PA... 36 0.068 AE014134-2522|AAF53410.1| 384|Drosophila melanogaster CG4701-PA... 36 0.068 AE013599-469|AAF59219.1| 433|Drosophila melanogaster CG1341-PA ... 36 0.068 AY058790-1|AAL14019.1| 523|Drosophila melanogaster SD09735p pro... 35 0.090 AE014134-581|AAF51127.2| 523|Drosophila melanogaster CG3326-PA ... 35 0.090 AY119493-1|AAM50147.1| 369|Drosophila melanogaster GH08677p pro... 35 0.12 AY089267-1|AAL90005.1| 398|Drosophila melanogaster AT06668p pro... 35 0.12 AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative mic... 35 0.12 AE014296-2061|AAF49987.1| 398|Drosophila melanogaster CG7257-PA... 35 0.12 AE014134-1827|AAF52903.1| 369|Drosophila melanogaster CG5395-PA... 35 0.12 U97685-1|AAB58311.1| 986|Drosophila melanogaster replication fa... 34 0.16 L17340-1|AAA28573.1| 986|Drosophila melanogaster transcription ... 34 0.16 BT030136-1|ABN49275.1| 1239|Drosophila melanogaster IP16981p pro... 34 0.16 BT003618-1|AAO39621.1| 986|Drosophila melanogaster GH06471p pro... 34 0.16 AY122077-1|AAM52589.1| 1008|Drosophila melanogaster AT18625p pro... 34 0.16 AY119188-1|AAM51048.1| 332|Drosophila melanogaster SD11293p pro... 34 0.16 AY058616-1|AAL13845.1| 508|Drosophila melanogaster LD30988p pro... 34 0.16 AF247499-1|AAF63387.1| 332|Drosophila melanogaster replication ... 34 0.16 AF229928-1|AAF33404.1| 554|Drosophila melanogaster cytoplasmic ... 34 0.16 AF227210-1|AAF43016.1| 604|Drosophila melanogaster AAA family p... 34 0.16 AF227209-1|AAF43014.1| 604|Drosophila melanogaster AAA family p... 34 0.16 AF160882-1|AAD46823.1| 428|Drosophila melanogaster GH12068p pro... 34 0.16 AF145305-1|AAF08386.1| 428|Drosophila melanogaster 26S proteaso... 34 0.16 AE014297-3377|AAF56177.1| 428|Drosophila melanogaster CG10370-P... 34 0.16 AE014297-2170|AAF55289.2| 604|Drosophila melanogaster CG6815-PA... 34 0.16 AE014297-166|AAF52082.1| 986|Drosophila melanogaster CG1119-PA,... 34 0.16 AE014297-165|AAX52937.1| 1008|Drosophila melanogaster CG1119-PB,... 34 0.16 AE014134-1878|AAF52944.2| 332|Drosophila melanogaster CG5313-PA... 34 0.16 AE013599-1353|AAF58611.2| 5303|Drosophila melanogaster CG13185-P... 34 0.16 BT001351-1|AAN71106.1| 758|Drosophila melanogaster AT25963p pro... 33 0.27 BT001254-1|AAN71010.1| 758|Drosophila melanogaster AT01057p pro... 33 0.27 AY069522-1|AAL39667.1| 551|Drosophila melanogaster LD23843p pro... 33 0.27 AY051787-1|AAK93211.1| 832|Drosophila melanogaster LD30525p pro... 33 0.27 AF134402-1|AAD24194.1| 431|Drosophila melanogaster Tat-binding ... 33 0.27 AE014297-3441|AAN13975.2| 758|Drosophila melanogaster CG5977-PB... 33 0.27 AE014297-3440|AAF56223.3| 758|Drosophila melanogaster CG5977-PA... 33 0.27 AE014296-3184|AAN11654.1| 832|Drosophila melanogaster CG8798-PB... 33 0.27 AE014296-3183|AAF49134.1| 1006|Drosophila melanogaster CG8798-PA... 33 0.27 AY075423-1|AAL68239.1| 1006|Drosophila melanogaster LD43687p pro... 33 0.48 AJ243811-1|CAB51031.1| 1006|Drosophila melanogaster l(3)70Da pro... 33 0.48 AE014296-2356|AAF49760.1| 1006|Drosophila melanogaster CG6760-PA... 33 0.48 U30502-1|AAA75044.1| 752|Drosophila melanogaster Drosophila N-e... 32 0.63 U28836-1|AAC46844.1| 744|Drosophila melanogaster N-ethylmaleimi... 32 0.63 U09373-1|AAA83413.1| 745|Drosophila melanogaster N-ethylmaleimi... 32 0.63 BT023784-1|AAZ41793.1| 752|Drosophila melanogaster LD09622p pro... 32 0.63 BT010259-1|AAQ23577.1| 745|Drosophila melanogaster RE33604p pro... 32 0.63 AY094902-1|AAM11255.1| 751|Drosophila melanogaster RH08189p pro... 32 0.63 AE014298-1870|AAF48244.2| 745|Drosophila melanogaster CG1618-PA... 32 0.63 AE014297-1767|AAF54995.2| 752|Drosophila melanogaster CG33101-P... 32 0.63 AE014297-972|AAF54404.3| 793|Drosophila melanogaster CG16789-PA... 32 0.63 BT001521-1|AAN71276.1| 297|Drosophila melanogaster LP12034p pro... 32 0.83 AY094968-1|AAM11321.1| 874|Drosophila melanogaster SD07712p pro... 32 0.83 AF287273-1|AAL02426.1| 993|Drosophila melanogaster DNA replicat... 32 0.83 AF124503-1|AAD31692.1| 520|Drosophila melanogaster DNA repair p... 32 0.83 AF076839-1|AAC95521.1| 520|Drosophila melanogaster Rad17-like p... 32 0.83 AE014297-1884|AAF55086.2| 535|Drosophila melanogaster CG7825-PA... 32 0.83 AE014134-661|AAN10380.2| 993|Drosophila melanogaster CG33122-PA... 32 0.83 AE013599-985|AAF58864.1| 297|Drosophila melanogaster CG2331-PB,... 32 0.83 AY069598-1|AAL39743.1| 353|Drosophila melanogaster LD35209p pro... 31 1.5 AE014298-2614|AAF48768.2| 353|Drosophila melanogaster CG8142-PA... 31 1.5 AY071291-1|AAL48913.1| 535|Drosophila melanogaster RE31829p pro... 30 2.5 AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin pro... 30 2.5 AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC... 30 2.5 U43505-1|AAC46956.1| 460|Drosophila melanogaster DmORC5 protein. 30 3.4 AY089590-1|AAL90328.1| 460|Drosophila melanogaster RE16687p pro... 30 3.4 AE014134-2409|AAF53340.1| 460|Drosophila melanogaster CG7833-PA... 30 3.4 AY089691-1|AAL90429.1| 431|Drosophila melanogaster RH68195p pro... 29 4.5 AY075442-1|ABF85762.1| 437|Drosophila melanogaster RE04126p pro... 29 4.5 AE014134-1783|AAN10723.1| 431|Drosophila melanogaster CG4908-PB... 29 4.5 AE014134-1782|AAF52876.1| 431|Drosophila melanogaster CG4908-PA... 29 4.5 BT009996-1|AAQ22465.1| 1483|Drosophila melanogaster RE35509p pro... 29 5.9 AY129431-1|AAM76173.1| 1006|Drosophila melanogaster GM03621p pro... 29 5.9 AY119579-1|AAM50233.1| 634|Drosophila melanogaster LD08709p pro... 29 5.9 AY118983-1|AAM50843.1| 872|Drosophila melanogaster LP02069p pro... 29 5.9 AE014297-1400|AAS65141.1| 1477|Drosophila melanogaster CG31368-P... 29 5.9 AE014297-1399|AAF54713.3| 1480|Drosophila melanogaster CG31368-P... 29 5.9 AE014296-984|AAF50757.1| 634|Drosophila melanogaster CG10583-PA... 29 5.9 BT001876-1|AAN71648.1| 507|Drosophila melanogaster SD10626p pro... 29 7.8 >AY061095-1|AAL28643.1| 456|Drosophila melanogaster LD08555p protein. Length = 456 Score = 231 bits (564), Expect = 9e-61 Identities = 112/133 (84%), Positives = 125/133 (93%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLME 433 LI+SKKMAGRALLLAGPPGTGKTAIALAIAQELG KVPFCPMVGSEV+S EIKKTEVLME Sbjct: 55 LIKSKKMAGRALLLAGPPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLME 114 Query: 434 NFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLDP 613 NFRR+IGLRIRETKEVYEGEVTELT ++ + GGYGKT+S+V+IGLKTAKGTKQLKLDP Sbjct: 115 NFRRSIGLRIRETKEVYEGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDP 174 Query: 614 TIYESLPKEKVEV 652 +I+++L KEKVEV Sbjct: 175 SIFDALQKEKVEV 187 Score = 90.2 bits (214), Expect = 2e-18 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +3 Query: 93 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVD**EVRK 272 MKIEEVKST +TQRI+AHSH+KGLGLDE G + AAGLVGQ++AREAAGIVVD + +K Sbjct: 1 MKIEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHSAAGLVGQKAAREAAGIVVDLIKSKK 60 Query: 273 WPG 281 G Sbjct: 61 MAG 63 >AE014297-1128|AAF54514.1| 456|Drosophila melanogaster CG4003-PA protein. Length = 456 Score = 231 bits (564), Expect = 9e-61 Identities = 112/133 (84%), Positives = 125/133 (93%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLME 433 LI+SKKMAGRALLLAGPPGTGKTAIALAIAQELG KVPFCPMVGSEV+S EIKKTEVLME Sbjct: 55 LIKSKKMAGRALLLAGPPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLME 114 Query: 434 NFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLDP 613 NFRR+IGLRIRETKEVYEGEVTELT ++ + GGYGKT+S+V+IGLKTAKGTKQLKLDP Sbjct: 115 NFRRSIGLRIRETKEVYEGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDP 174 Query: 614 TIYESLPKEKVEV 652 +I+++L KEKVEV Sbjct: 175 SIFDALQKEKVEV 187 Score = 90.2 bits (214), Expect = 2e-18 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +3 Query: 93 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVD**EVRK 272 MKIEEVKST +TQRI+AHSH+KGLGLDE G + AAGLVGQ++AREAAGIVVD + +K Sbjct: 1 MKIEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHSAAGLVGQKAAREAAGIVVDLIKSKK 60 Query: 273 WPG 281 G Sbjct: 61 MAG 63 >AF233278-1|AAF43411.1| 456|Drosophila melanogaster pontin protein. Length = 456 Score = 227 bits (556), Expect = 8e-60 Identities = 111/133 (83%), Positives = 124/133 (93%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLME 433 LI+SKKMAGRALLLAG PGTGKTAIALAIAQELG KVPFCPMVGSEV+S EIKKTEVLME Sbjct: 55 LIKSKKMAGRALLLAGAPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLME 114 Query: 434 NFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLDP 613 NFRR+IGLRIRETKEVYEGEVTELT ++ + GGYGKT+S+V+IGLKTAKGTKQLKLDP Sbjct: 115 NFRRSIGLRIRETKEVYEGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDP 174 Query: 614 TIYESLPKEKVEV 652 +I+++L KEKVEV Sbjct: 175 SIFDALQKEKVEV 187 Score = 90.2 bits (214), Expect = 2e-18 Identities = 44/63 (69%), Positives = 52/63 (82%) Frame = +3 Query: 93 MKIEEVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVVD**EVRK 272 MKIEEVKST +TQRI+AHSH+KGLGLDE G + AAGLVGQ++AREAAGIVVD + +K Sbjct: 1 MKIEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHSAAGLVGQKAAREAAGIVVDLIKSKK 60 Query: 273 WPG 281 G Sbjct: 61 MAG 63 >AY061155-1|AAL28703.1| 481|Drosophila melanogaster LD12420p protein. Length = 481 Score = 113 bits (272), Expect = 2e-25 Identities = 61/133 (45%), Positives = 84/133 (63%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 +++R K+AGR +LLAG P TGKTAIA+ +AQ LGT+ PF M GSE+YS E+ KTE L Sbjct: 57 QMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALS 116 Query: 431 ENFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLD 610 + R++IG+RI+E E+ EGEV E+ + + A G G+ V V LKT + L Sbjct: 117 QALRKSIGVRIKEETEIIEGEVVEIQIERP---ASGTGQKVGKVT--LKTTEMETNYDLG 171 Query: 611 PTIYESLPKEKVE 649 I E KEK++ Sbjct: 172 NKIIECFMKEKIQ 184 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +3 Query: 105 EVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVV 251 EV+ + +RI AHSHI+GLGLD+ ++ G+VGQ+ AR AAG+VV Sbjct: 8 EVRDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVV 56 >AY060952-1|AAL28500.1| 481|Drosophila melanogaster GM08688p protein. Length = 481 Score = 113 bits (272), Expect = 2e-25 Identities = 61/133 (45%), Positives = 84/133 (63%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 +++R K+AGR +LLAG P TGKTAIA+ +AQ LGT+ PF M GSE+YS E+ KTE L Sbjct: 57 QMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALS 116 Query: 431 ENFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLD 610 + R++IG+RI+E E+ EGEV E+ + + A G G+ V V LKT + L Sbjct: 117 QALRKSIGVRIKEETEIIEGEVVEIQIERP---ASGTGQKVGKVT--LKTTEMETNYDLG 171 Query: 611 PTIYESLPKEKVE 649 I E KEK++ Sbjct: 172 NKIIECFMKEKIQ 184 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +3 Query: 105 EVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVV 251 EV+ + +RI AHSHI+GLGLD+ ++ G+VGQ+ AR AAG+VV Sbjct: 8 EVRDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVV 56 >AF233279-1|AAF43412.1| 481|Drosophila melanogaster reptin protein. Length = 481 Score = 113 bits (272), Expect = 2e-25 Identities = 61/133 (45%), Positives = 84/133 (63%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 +++R K+AGR +LLAG P TGKTAIA+ +AQ LGT+ PF M GSE+YS E+ KTE L Sbjct: 57 QMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALS 116 Query: 431 ENFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLD 610 + R++IG+RI+E E+ EGEV E+ + + A G G+ V V LKT + L Sbjct: 117 QALRKSIGVRIKEETEIIEGEVVEIQIERP---ASGTGQKVGKVT--LKTTEMETNYDLG 171 Query: 611 PTIYESLPKEKVE 649 I E KEK++ Sbjct: 172 NKIIECFMKEKIQ 184 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +3 Query: 105 EVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVV 251 EV+ + +RI AHSHI+GLGLD+ ++ G+VGQ+ AR AAG+VV Sbjct: 8 EVRDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVV 56 >AE014296-3115|AAF49182.1| 481|Drosophila melanogaster CG9750-PA protein. Length = 481 Score = 113 bits (272), Expect = 2e-25 Identities = 61/133 (45%), Positives = 84/133 (63%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 +++R K+AGR +LLAG P TGKTAIA+ +AQ LGT+ PF M GSE+YS E+ KTE L Sbjct: 57 QMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALS 116 Query: 431 ENFRRAIGLRIRETKEVYEGEVTELTLLKQKILAGGYGKTVSHVIIGLKTAKGTKQLKLD 610 + R++IG+RI+E E+ EGEV E+ + + A G G+ V V LKT + L Sbjct: 117 QALRKSIGVRIKEETEIIEGEVVEIQIERP---ASGTGQKVGKVT--LKTTEMETNYDLG 171 Query: 611 PTIYESLPKEKVE 649 I E KEK++ Sbjct: 172 NKIIECFMKEKIQ 184 Score = 54.4 bits (125), Expect = 1e-07 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = +3 Query: 105 EVKSTAKTQRISAHSHIKGLGLDENGVPIQMAAGLVGQESAREAAGIVV 251 EV+ + +RI AHSHI+GLGLD+ ++ G+VGQ+ AR AAG+VV Sbjct: 8 EVRDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVV 56 >AF145606-1|AAD38581.1| 442|Drosophila melanogaster BcDNA.GH02678 protein. Length = 442 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/62 (33%), Positives = 38/62 (61%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 +L K++ + +LL GPPGTGK+ +A A+A E + F + S++ S + ++E L+ Sbjct: 156 QLFTGKRIPWKGILLFGPPGTGKSYLAKAVATE-ANRSTFFSVSSSDLMSKWLGESEKLV 214 Query: 431 EN 436 +N Sbjct: 215 KN 216 >AE014298-2640|AAF48783.1| 442|Drosophila melanogaster CG6842-PA protein. Length = 442 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/62 (33%), Positives = 38/62 (61%) Frame = +2 Query: 251 RLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLM 430 +L K++ + +LL GPPGTGK+ +A A+A E + F + S++ S + ++E L+ Sbjct: 156 QLFTGKRIPWKGILLFGPPGTGKSYLAKAVATE-ANRSTFFSVSSSDLMSKWLGESEKLV 214 Query: 431 EN 436 +N Sbjct: 215 KN 216 >AY118458-1|AAM49827.1| 504|Drosophila melanogaster GH01006p protein. Length = 504 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R LL GPPG GKT +A A+A E +VPF M GSE Sbjct: 375 RGALLLGPPGCGKTLLAKAVATE--AQVPFLSMNGSE 409 >AL023874-1|CAA19646.1| 819|Drosophila melanogaster EG:100G10.7 protein. Length = 819 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R LL GPPG GKT +A A+A E +VPF M GSE Sbjct: 375 RGALLLGPPGCGKTLLAKAVATE--AQVPFLSMNGSE 409 >AE014298-443|AAS65257.1| 504|Drosophila melanogaster CG2658-PB, isoform B protein. Length = 504 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R LL GPPG GKT +A A+A E +VPF M GSE Sbjct: 375 RGALLLGPPGCGKTLLAKAVATE--AQVPFLSMNGSE 409 >AE014298-442|AAF45806.1| 819|Drosophila melanogaster CG2658-PA, isoform A protein. Length = 819 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/37 (56%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R LL GPPG GKT +A A+A E +VPF M GSE Sbjct: 375 RGALLLGPPGCGKTLLAKAVATE--AQVPFLSMNGSE 409 >AY051480-1|AAK92904.1| 736|Drosophila melanogaster GH14313p protein. Length = 736 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + +LL GPPGTGKT +A A+A E KVPF G E Sbjct: 334 KGVLLVGPPGTGKTLLARAVAGE--AKVPFFHAAGPE 368 >AE013599-3496|AAM71132.2| 736|Drosophila melanogaster CG3499-PB protein. Length = 736 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/37 (54%), Positives = 24/37 (64%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + +LL GPPGTGKT +A A+A E KVPF G E Sbjct: 334 KGVLLVGPPGTGKTLLARAVAGE--AKVPFFHAAGPE 368 >BT023721-1|AAY85121.1| 673|Drosophila melanogaster AT01259p protein. Length = 673 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 R +L+ GPPGTGKT +A A+A E GT Sbjct: 428 RGVLMVGPPGTGKTMLAKAVATECGT 453 >BT001274-1|AAN71030.1| 669|Drosophila melanogaster AT05655p protein. Length = 669 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 R +L+ GPPGTGKT +A A+A E GT Sbjct: 424 RGVLMVGPPGTGKTMLAKAVATECGT 449 >AY051591-1|AAK93015.1| 605|Drosophila melanogaster GH23455p protein. Length = 605 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 R +L+ GPPGTGKT +A A+A E GT Sbjct: 360 RGVLMVGPPGTGKTMLAKAVATECGT 385 >AE014297-353|AAF51954.1| 669|Drosophila melanogaster CG1193-PB, isoform B protein. Length = 669 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 R +L+ GPPGTGKT +A A+A E GT Sbjct: 424 RGVLMVGPPGTGKTMLAKAVATECGT 449 >AE014297-352|AAF51955.2| 605|Drosophila melanogaster CG1193-PA, isoform A protein. Length = 605 Score = 39.1 bits (87), Expect = 0.006 Identities = 16/26 (61%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 R +L+ GPPGTGKT +A A+A E GT Sbjct: 360 RGVLMVGPPGTGKTMLAKAVATECGT 385 >AY058375-1|AAL13604.1| 897|Drosophila melanogaster GH14288p protein. Length = 897 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +2 Query: 257 IRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LME 433 + K + +LL GPPGTGKT +A A+A E + F + G E+ + + ++E + E Sbjct: 641 LMGKNLRRSGILLYGPPGTGKTLVAKAVATE--CNLSFLSVQGPELLNMYVGQSEQNVRE 698 Query: 434 NFRRA 448 F RA Sbjct: 699 VFSRA 703 Score = 31.1 bits (67), Expect = 1.5 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +2 Query: 263 SKKMAGRALLLAGPPGTGKTAIALAIAQELGTKV--PFCPMVGSEVYS-TEIKKTEVLME 433 S K LL G G+GK+ + A+AQELG + C + S+V S TE+K V + Sbjct: 356 SSKHIFPVFLLQGERGSGKSKLVSAVAQELGMHIYGADCAEIVSQVPSHTEMKLKAVFAK 415 Query: 434 N 436 + Sbjct: 416 S 416 >AE013599-1191|AAF58736.3| 897|Drosophila melanogaster CG11919-PA, isoform A protein. Length = 897 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +2 Query: 257 IRSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEV-LME 433 + K + +LL GPPGTGKT +A A+A E + F + G E+ + + ++E + E Sbjct: 641 LMGKNLRRSGILLYGPPGTGKTLVAKAVATE--CNLSFLSVQGPELLNMYVGQSEQNVRE 698 Query: 434 NFRRA 448 F RA Sbjct: 699 VFSRA 703 Score = 31.1 bits (67), Expect = 1.5 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 3/61 (4%) Frame = +2 Query: 263 SKKMAGRALLLAGPPGTGKTAIALAIAQELGTKV--PFCPMVGSEVYS-TEIKKTEVLME 433 S K LL G G+GK+ + A+AQELG + C + S+V S TE+K V + Sbjct: 356 SSKHIFPVFLLQGERGSGKSKLVSAVAQELGMHIYGADCAEIVSQVPSHTEMKLKAVFAK 415 Query: 434 N 436 + Sbjct: 416 S 416 >U39303-1|AAB34134.1| 439|Drosophila melanogaster P26s4 protein. Length = 439 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + ++L GPPGTGKT +A A+A + T F +VGSE+ Sbjct: 219 KGVILYGPPGTGKTLLAKAVANQ--TSATFLRVVGSEL 254 >AY058759-1|AAL13988.1| 439|Drosophila melanogaster SD02658p protein. Length = 439 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + ++L GPPGTGKT +A A+A + T F +VGSE+ Sbjct: 219 KGVILYGPPGTGKTLLAKAVANQ--TSATFLRVVGSEL 254 >AF202034-1|AAF17568.1| 799|Drosophila melanogaster endoplasmic reticulum membranefusion protein protein. Length = 799 Score = 38.3 bits (85), Expect = 0.010 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRA 448 R +L+ GPPGTGKT IA A+A E G F + G E+ S ++E N R+A Sbjct: 236 RGILMYGPPGTGKTLIARAVANETGAF--FFLINGPEIMSKLAGESE---SNLRKA 286 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 R +L GPPG GKT A AIA E Sbjct: 509 RGVLFYGPPGCGKTLPAKAIANE 531 >AF132553-1|AAD27852.1| 801|Drosophila melanogaster BcDNA.GM02885 protein. Length = 801 Score = 38.3 bits (85), Expect = 0.010 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRA 448 R +L+ GPPGTGKT IA A+A E G F + G E+ S ++E N R+A Sbjct: 236 RGILMYGPPGTGKTLIARAVANETGAF--FFLINGPEIMSKLAGESE---SNLRKA 286 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 R +L GPPG GKT +A AIA E Sbjct: 509 RGVLFYGPPGCGKTLLAKAIANE 531 >AF047037-1|AAC27447.1| 801|Drosophila melanogaster transitional endoplasmic reticulumATPase TER94 protein. Length = 801 Score = 38.3 bits (85), Expect = 0.010 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRA 448 R +L+ GPPGTGKT IA A+A E G F + G E+ S ++E N R+A Sbjct: 236 RGILMYGPPGTGKTLIARAVANETGAF--FFLINGPEIMSKLAGESE---SNLRKA 286 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 R +L GPPG GKT +A AIA E Sbjct: 509 RGVLFYGPPGCGKTLLAKAIANE 531 >AE014297-3409|AAF56205.1| 439|Drosophila melanogaster CG5289-PA protein. Length = 439 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + ++L GPPGTGKT +A A+A + T F +VGSE+ Sbjct: 219 KGVILYGPPGTGKTLLAKAVANQ--TSATFLRVVGSEL 254 >AE013599-984|AAF58863.1| 801|Drosophila melanogaster CG2331-PA, isoform A protein. Length = 801 Score = 38.3 bits (85), Expect = 0.010 Identities = 24/56 (42%), Positives = 32/56 (57%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRA 448 R +L+ GPPGTGKT IA A+A E G F + G E+ S ++E N R+A Sbjct: 236 RGILMYGPPGTGKTLIARAVANETGAF--FFLINGPEIMSKLAGESE---SNLRKA 286 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 R +L GPPG GKT +A AIA E Sbjct: 509 RGVLFYGPPGCGKTLLAKAIANE 531 >X99207-1|CAA67594.1| 943|Drosophila melanogaster smallminded protein. Length = 943 Score = 37.9 bits (84), Expect = 0.013 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 448 A +LL GPPG GKT +A AIA E G + F + G E+ + + ++E + F+RA Sbjct: 694 APSGVLLCGPPGCGKTLLAKAIANEAG--INFISVKGPELMNMYVGESERAVRACFQRA 750 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 272 MAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE-VYSTEIKKTEVLMENFRRA 448 + R LLL GPPG GKT +A AI+ +L K+P + +E + + E + E F +A Sbjct: 281 LPSRGLLLHGPPGCGKTFLARAISGQL--KMPLMEIPATELIGGISGESEERIREVFDQA 338 Query: 449 IG 454 IG Sbjct: 339 IG 340 >AY071142-1|AAL48764.1| 572|Drosophila melanogaster RE17942p protein. Length = 572 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 + +L+ GPPGTGKT +A A+A E GT Sbjct: 327 KGVLMVGPPGTGKTMLAKAVATECGT 352 >AE014297-195|AAF52059.2| 572|Drosophila melanogaster CG10229-PA protein. Length = 572 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 + +L+ GPPGTGKT +A A+A E GT Sbjct: 327 KGVLMVGPPGTGKTMLAKAVATECGT 352 >AE014296-1253|AAS65065.1| 850|Drosophila melanogaster CG8571-PB, isoform B protein. Length = 850 Score = 37.9 bits (84), Expect = 0.013 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 448 A +LL GPPG GKT +A AIA E G + F + G E+ + + ++E + F+RA Sbjct: 601 APSGVLLCGPPGCGKTLLAKAIANEAG--INFISVKGPELMNMYVGESERAVRACFQRA 657 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 272 MAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE-VYSTEIKKTEVLMENFRRA 448 + R LLL GPPG GKT +A AI+ +L K+P + +E + + E + E F +A Sbjct: 188 LPSRGLLLHGPPGCGKTFLARAISGQL--KMPLMEIPATELIGGISGESEERIREVFDQA 245 Query: 449 IG 454 IG Sbjct: 246 IG 247 >AE014296-1252|AAF50566.1| 944|Drosophila melanogaster CG8571-PA, isoform A protein. Length = 944 Score = 37.9 bits (84), Expect = 0.013 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTE-VLMENFRRA 448 A +LL GPPG GKT +A AIA E G + F + G E+ + + ++E + F+RA Sbjct: 695 APSGVLLCGPPGCGKTLLAKAIANEAG--INFISVKGPELMNMYVGESERAVRACFQRA 751 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 272 MAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE-VYSTEIKKTEVLMENFRRA 448 + R LLL GPPG GKT +A AI+ +L K+P + +E + + E + E F +A Sbjct: 282 LPSRGLLLHGPPGCGKTFLARAISGQL--KMPLMEIPATELIGGISGESEERIREVFDQA 339 Query: 449 IG 454 IG Sbjct: 340 IG 341 >AY084199-1|AAL89937.1| 826|Drosophila melanogaster SD01613p protein. Length = 826 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + +L GPPGTGKT +A A A E VPF + GSE Sbjct: 362 KGAMLTGPPGTGKTLLAKATAGE--ANVPFITVSGSE 396 >AY075495-1|AAL68305.1| 501|Drosophila melanogaster RE47719p protein. Length = 501 Score = 37.5 bits (83), Expect = 0.017 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +2 Query: 272 MAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE-VYSTEIKKTEVLMENFRRA 448 + R LLL GPPG GKT +A AI+ +L K+P + +E + + E + E F +A Sbjct: 281 LPSRGLLLHGPPGCGKTFLARAISGQL--KMPLMEIPATELIGGISGESEERIREVFDQA 338 Query: 449 IG 454 IG Sbjct: 339 IG 340 >AE014296-2879|AAN11704.1| 697|Drosophila melanogaster CG6512-PB, isoform B protein. Length = 697 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + +L GPPGTGKT +A A A E VPF + GSE Sbjct: 233 KGAMLTGPPGTGKTLLAKATAGE--ANVPFITVSGSE 267 >AE014296-2878|AAF49365.2| 826|Drosophila melanogaster CG6512-PA, isoform A protein. Length = 826 Score = 37.5 bits (83), Expect = 0.017 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 + +L GPPGTGKT +A A A E VPF + GSE Sbjct: 362 KGAMLTGPPGTGKTLLAKATAGE--ANVPFITVSGSE 396 >AY094800-1|AAM11153.1| 421|Drosophila melanogaster LD24646p protein. Length = 421 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTK 361 R +LL GPPGTGKT++ A+AQ+L + Sbjct: 167 RLILLHGPPGTGKTSLCKALAQKLSIR 193 >AE014297-764|AAN13388.1| 421|Drosophila melanogaster CG31453-PA protein. Length = 421 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTK 361 R +LL GPPGTGKT++ A+AQ+L + Sbjct: 167 RLILLHGPPGTGKTSLCKALAQKLSIR 193 >BT016035-1|AAV36920.1| 405|Drosophila melanogaster RE01104p protein. Length = 405 Score = 36.3 bits (80), Expect = 0.039 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +LL GPPG GKT +A A+A T F +VGSE Sbjct: 187 RGVLLFGPPGCGKTMLAKAVAHH--TTASFIRVVGSE 221 >AY113319-1|AAM29324.1| 270|Drosophila melanogaster AT28212p protein. Length = 270 Score = 36.3 bits (80), Expect = 0.039 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +LL GPPG GKT +A A+A T F +VGSE Sbjct: 140 RGVLLFGPPGCGKTMLAKAVAHH--TTASFIRVVGSE 174 >AE014297-1026|AAF54440.1| 421|Drosophila melanogaster CG9475-PA, isoform A protein. Length = 421 Score = 36.3 bits (80), Expect = 0.039 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +LL GPPG GKT +A A+A T F +VGSE Sbjct: 203 RGVLLFGPPGCGKTMLAKAVAHH--TTASFIRVVGSE 237 >AE014297-1025|AAN13443.2| 389|Drosophila melanogaster CG9475-PB, isoform B protein. Length = 389 Score = 36.3 bits (80), Expect = 0.039 Identities = 19/37 (51%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +LL GPPG GKT +A A+A T F +VGSE Sbjct: 171 RGVLLFGPPGCGKTMLAKAVAHH--TTASFIRVVGSE 205 >U97538-1|AAC48284.1| 405|Drosophila melanogaster DUG protein. Length = 405 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 183 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 218 >AY119229-1|AAM51089.1| 399|Drosophila melanogaster SD17676p protein. Length = 399 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 178 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 213 >AY051732-1|AAK93156.1| 405|Drosophila melanogaster LD26005p protein. Length = 405 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 183 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 218 >AF043734-1|AAC63219.1| 405|Drosophila melanogaster Pros45 proteosome subunit homolog protein. Length = 405 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 183 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 218 >AE014298-3108|AAF50835.1| 405|Drosophila melanogaster CG1489-PA protein. Length = 405 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 183 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 218 >AE014297-4633|AAF57069.1| 399|Drosophila melanogaster CG2241-PA protein. Length = 399 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A+A T+ F + GSE+ Sbjct: 178 KGVLLYGPPGTGKTLLARAVAHH--TECTFIRVSGSEL 213 >AY113316-1|AAM29321.1| 384|Drosophila melanogaster AT28104p protein. Length = 384 Score = 35.5 bits (78), Expect = 0.068 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTK 361 A + +LL GPPG GKT IA AIA++ G + Sbjct: 129 APKGVLLHGPPGCGKTLIAKAIAKDAGMR 157 >AY089357-1|AAL90095.1| 479|Drosophila melanogaster AT18413p protein. Length = 479 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS 400 R+LLL GPPG+GKT +A A+ E +V F + S + S Sbjct: 240 RSLLLHGPPGSGKTLLAKALYSETQGQVTFFNITASIMVS 279 >AY071182-1|AAL48804.1| 397|Drosophila melanogaster RE23388p protein. Length = 397 Score = 35.5 bits (78), Expect = 0.068 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI-KKTEVLMENFRRA 448 + LL GPPGTGKT +A A+A +L F +V S + I + ++ E F A Sbjct: 176 KGCLLYGPPGTGKTLLARAVASQLDAN--FLKVVSSAIVDKYIGESARLIREMFNYA 230 >AY061606-1|AAL29154.1| 433|Drosophila melanogaster SD07148p protein. Length = 433 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT A A+A T F ++GSE+ Sbjct: 210 KGVLLFGPPGTGKTLCARAVANR--TDACFIRVIGSEL 245 >AF145310-1|AAF08391.1| 390|Drosophila melanogaster 26S proteasome regulatory complexsubunit p42D protein. Length = 390 Score = 35.5 bits (78), Expect = 0.068 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI-KKTEVLMENFRRA 448 + LL GPPGTGKT +A A+A +L F +V S + I + ++ E F A Sbjct: 169 KGCLLYGPPGTGKTLLARAVASQLDAN--FLKVVSSAIVDKYIGESARLIREMFNYA 223 >AF145307-1|AAF08388.1| 433|Drosophila melanogaster 26S proteasome regulatory complexsubunit p48B protein. Length = 433 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT A A+A T F ++GSE+ Sbjct: 210 KGVLLFGPPGTGKTLCARAVANR--TDACFIRVIGSEL 245 >AF145306-1|AAF08387.1| 413|Drosophila melanogaster 26S proteasome regulatory complexsubunit p48A protein. Length = 413 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +L+ GPPG GKT +A A+A T F +VGSE Sbjct: 195 RGVLMYGPPGCGKTMLAKAVAHH--TTASFIRVVGSE 229 >AE014298-1555|AAF48001.1| 413|Drosophila melanogaster CG16916-PA protein. Length = 413 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSE 391 R +L+ GPPG GKT +A A+A T F +VGSE Sbjct: 195 RGVLMYGPPGCGKTMLAKAVAHH--TTASFIRVVGSE 229 >AE014298-869|AAF46146.2| 390|Drosophila melanogaster CG3455-PA protein. Length = 390 Score = 35.5 bits (78), Expect = 0.068 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI-KKTEVLMENFRRA 448 + LL GPPGTGKT +A A+A +L F +V S + I + ++ E F A Sbjct: 169 KGCLLYGPPGTGKTLLARAVASQLDAN--FLKVVSSAIVDKYIGESARLIREMFNYA 223 >AE014298-515|AAF45864.1| 479|Drosophila melanogaster CG10793-PA protein. Length = 479 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYS 400 R+LLL GPPG+GKT +A A+ E +V F + S + S Sbjct: 240 RSLLLHGPPGSGKTLLAKALYSETQGQVTFFNITASIMVS 279 >AE014134-2522|AAF53410.1| 384|Drosophila melanogaster CG4701-PA protein. Length = 384 Score = 35.5 bits (78), Expect = 0.068 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTK 361 A + +LL GPPG GKT IA AIA++ G + Sbjct: 129 APKGVLLHGPPGCGKTLIAKAIAKDAGMR 157 >AE013599-469|AAF59219.1| 433|Drosophila melanogaster CG1341-PA protein. Length = 433 Score = 35.5 bits (78), Expect = 0.068 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT A A+A T F ++GSE+ Sbjct: 210 KGVLLFGPPGTGKTLCARAVANR--TDACFIRVIGSEL 245 >AY058790-1|AAL14019.1| 523|Drosophila melanogaster SD09735p protein. Length = 523 Score = 35.1 bits (77), Expect = 0.090 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTK 361 R +LL GPPGTGKT IA +IA + K Sbjct: 284 RGVLLFGPPGTGKTLIAKSIASQAKAK 310 >AE014134-581|AAF51127.2| 523|Drosophila melanogaster CG3326-PA protein. Length = 523 Score = 35.1 bits (77), Expect = 0.090 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTK 361 R +LL GPPGTGKT IA +IA + K Sbjct: 284 RGVLLFGPPGTGKTLIAKSIASQAKAK 310 >AY119493-1|AAM50147.1| 369|Drosophila melanogaster GH08677p protein. Length = 369 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTK 361 A + +LL GPPG GKT IA A A+E G + Sbjct: 131 APKGVLLHGPPGCGKTLIAKATAKEAGMR 159 >AY089267-1|AAL90005.1| 398|Drosophila melanogaster AT06668p protein. Length = 398 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI-KKTEVLMENFRRA 448 + LL GPPGTGKT +A AIA ++ F +V S + I + ++ E F A Sbjct: 177 KGCLLYGPPGTGKTLLARAIASQMDAN--FLKVVSSAIVDKYIGESARLIREMFAYA 231 >AF223064-1|AAF34687.1| 571|Drosophila melanogaster putative microtubule severingprotein katanin p60 subunit protein. Length = 571 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGT 358 + +L+ GP GTGKT +A A+A E GT Sbjct: 327 KGVLMVGPSGTGKTMLAKAVATECGT 352 >AE014296-2061|AAF49987.1| 398|Drosophila melanogaster CG7257-PA protein. Length = 398 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEI-KKTEVLMENFRRA 448 + LL GPPGTGKT +A AIA ++ F +V S + I + ++ E F A Sbjct: 177 KGCLLYGPPGTGKTLLARAIASQMDAN--FLKVVSSAIVDKYIGESARLIREMFAYA 231 >AE014134-1827|AAF52903.1| 369|Drosophila melanogaster CG5395-PA protein. Length = 369 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +2 Query: 275 AGRALLLAGPPGTGKTAIALAIAQELGTK 361 A + +LL GPPG GKT IA A A+E G + Sbjct: 131 APKGVLLHGPPGCGKTLIAKATAKEAGMR 159 >U97685-1|AAB58311.1| 986|Drosophila melanogaster replication factor C large subunit protein. Length = 986 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + +ELG Sbjct: 481 KAALLSGPPGIGKTTTATLVVKELG 505 >L17340-1|AAA28573.1| 986|Drosophila melanogaster transcription factor protein. Length = 986 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + +ELG Sbjct: 481 KAALLSGPPGIGKTTTATLVVKELG 505 >BT030136-1|ABN49275.1| 1239|Drosophila melanogaster IP16981p protein. Length = 1239 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG---TKVPFCPMVG-SEVYSTEIKKTEVLMENFRRA 448 + +LL GPPG GKT+I +I +G ++ C ++++ T++ + L+E+ A Sbjct: 187 KPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTAA 246 Query: 449 IGLRIR 466 +IR Sbjct: 247 TERQIR 252 >BT003618-1|AAO39621.1| 986|Drosophila melanogaster GH06471p protein. Length = 986 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + +ELG Sbjct: 481 KAALLSGPPGIGKTTTATLVVKELG 505 >AY122077-1|AAM52589.1| 1008|Drosophila melanogaster AT18625p protein. Length = 1008 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + +ELG Sbjct: 503 KAALLSGPPGIGKTTTATLVVKELG 527 >AY119188-1|AAM51048.1| 332|Drosophila melanogaster SD11293p protein. Length = 332 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMV 382 LL GPPGTGKT+ LA A++L + F MV Sbjct: 47 LLFYGPPGTGKTSTILACARQLYSPQQFKSMV 78 >AY058616-1|AAL13845.1| 508|Drosophila melanogaster LD30988p protein. Length = 508 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 260 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 R K R +L+ GPPGTGKT A +A+ G + F M G +V Sbjct: 345 RINKGMYRNVLMHGPPGTGKTMFAKKLAEHSG--MDFAIMTGGDV 387 >AF247499-1|AAF63387.1| 332|Drosophila melanogaster replication factor C subunit 3 protein. Length = 332 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMV 382 LL GPPGTGKT+ LA A++L + F MV Sbjct: 47 LLFYGPPGTGKTSTILACARQLYSPQQFKSMV 78 >AF229928-1|AAF33404.1| 554|Drosophila melanogaster cytoplasmic protein 89BC protein. Length = 554 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 260 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 R K R +L+ GPPGTGKT A +A+ G + F M G +V Sbjct: 295 RINKGMYRNVLMHGPPGTGKTMFAKKLAEHSG--MDFAIMTGGDV 337 >AF227210-1|AAF43016.1| 604|Drosophila melanogaster AAA family protein Bor protein. Length = 604 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 260 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 R K R +L+ GPPGTGKT A +A+ G + F M G +V Sbjct: 345 RINKGMYRNVLMHGPPGTGKTMFAKKLAEHSG--MDFAIMTGGDV 387 >AF227209-1|AAF43014.1| 604|Drosophila melanogaster AAA family protein Bor protein. Length = 604 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 260 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 R K R +L+ GPPGTGKT A +A+ G + F M G +V Sbjct: 345 RINKGMYRNVLMHGPPGTGKTMFAKKLAEHSG--MDFAIMTGGDV 387 >AF160882-1|AAD46823.1| 428|Drosophila melanogaster GH12068p protein. Length = 428 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A A + TK F + G ++ Sbjct: 210 KGVLLYGPPGTGKTLLARACAAQ--TKSTFLKLAGPQL 245 >AF145305-1|AAF08386.1| 428|Drosophila melanogaster 26S proteasome regulatory complexsubunit p50 protein. Length = 428 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A A + TK F + G ++ Sbjct: 210 KGVLLYGPPGTGKTLLARACAAQ--TKSTFLKLAGPQL 245 >AE014297-3377|AAF56177.1| 428|Drosophila melanogaster CG10370-PA protein. Length = 428 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/38 (44%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + +LL GPPGTGKT +A A A + TK F + G ++ Sbjct: 210 KGVLLYGPPGTGKTLLARACAAQ--TKSTFLKLAGPQL 245 >AE014297-2170|AAF55289.2| 604|Drosophila melanogaster CG6815-PA protein. Length = 604 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 260 RSKKMAGRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 R K R +L+ GPPGTGKT A +A+ G + F M G +V Sbjct: 345 RINKGMYRNVLMHGPPGTGKTMFAKKLAEHSG--MDFAIMTGGDV 387 >AE014297-166|AAF52082.1| 986|Drosophila melanogaster CG1119-PA, isoform A protein. Length = 986 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + +ELG Sbjct: 481 KAALLSGPPGIGKTTTATLVVKELG 505 >AE014297-165|AAX52937.1| 1008|Drosophila melanogaster CG1119-PB, isoform B protein. Length = 1008 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 +A LL+GPPG GKT A + +ELG Sbjct: 503 KAALLSGPPGIGKTTTATLVVKELG 527 >AE014134-1878|AAF52944.2| 332|Drosophila melanogaster CG5313-PA protein. Length = 332 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMV 382 LL GPPGTGKT+ LA A++L + F MV Sbjct: 47 LLFYGPPGTGKTSTILACARQLYSPQQFKSMV 78 >AE013599-1353|AAF58611.2| 5303|Drosophila melanogaster CG13185-PA protein. Length = 5303 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 4/66 (6%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG---TKVPFCPMVG-SEVYSTEIKKTEVLMENFRRA 448 + +LL GPPG GKT+I +I +G ++ C ++++ T++ + L+E+ A Sbjct: 1758 KPVLLEGPPGVGKTSIVESIGSAIGYQIVRINLCEHTDLADLFGTDLPAEDNLLESNTAA 1817 Query: 449 IGLRIR 466 +IR Sbjct: 1818 TERQIR 1823 >BT001351-1|AAN71106.1| 758|Drosophila melanogaster AT25963p protein. Length = 758 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQE 349 L + + LLL GPPG GKT +A A+A E Sbjct: 508 LFTGLRAPAKGLLLFGPPGNGKTLLARAVATE 539 >BT001254-1|AAN71010.1| 758|Drosophila melanogaster AT01057p protein. Length = 758 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQE 349 L + + LLL GPPG GKT +A A+A E Sbjct: 508 LFTGLRAPAKGLLLFGPPGNGKTLLARAVATE 539 >AY069522-1|AAL39667.1| 551|Drosophila melanogaster LD23843p protein. Length = 551 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQE 349 L + + LLL GPPG GKT +A A+A E Sbjct: 301 LFTGLRAPAKGLLLFGPPGNGKTLLARAVATE 332 >AY051787-1|AAK93211.1| 832|Drosophila melanogaster LD30525p protein. Length = 832 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +2 Query: 278 GRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIK 412 G+ L GPPG GKT+IA +IA+ L + F VG EIK Sbjct: 365 GKILCFHGPPGVGKTSIAKSIARALNREY-FRFSVGGMTDVAEIK 408 >AF134402-1|AAD24194.1| 431|Drosophila melanogaster Tat-binding protein-1 protein. Length = 431 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEV 394 + ++L GPPGTGKT +A A A + TK F + G ++ Sbjct: 214 KGVILYGPPGTGKTLLARACAAQ--TKSTFLKLAGPQL 249 >AE014297-3441|AAN13975.2| 758|Drosophila melanogaster CG5977-PB, isoform B protein. Length = 758 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQE 349 L + + LLL GPPG GKT +A A+A E Sbjct: 508 LFTGLRAPAKGLLLFGPPGNGKTLLARAVATE 539 >AE014297-3440|AAF56223.3| 758|Drosophila melanogaster CG5977-PA, isoform A protein. Length = 758 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 Query: 254 LIRSKKMAGRALLLAGPPGTGKTAIALAIAQE 349 L + + LLL GPPG GKT +A A+A E Sbjct: 508 LFTGLRAPAKGLLLFGPPGNGKTLLARAVATE 539 >AE014296-3184|AAN11654.1| 832|Drosophila melanogaster CG8798-PB, isoform B protein. Length = 832 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +2 Query: 278 GRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIK 412 G+ L GPPG GKT+IA +IA+ L + F VG EIK Sbjct: 365 GKILCFHGPPGVGKTSIAKSIARALNREY-FRFSVGGMTDVAEIK 408 >AE014296-3183|AAF49134.1| 1006|Drosophila melanogaster CG8798-PA, isoform A protein. Length = 1006 Score = 33.5 bits (73), Expect = 0.27 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = +2 Query: 278 GRALLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIK 412 G+ L GPPG GKT+IA +IA+ L + F VG EIK Sbjct: 539 GKILCFHGPPGVGKTSIAKSIARALNREY-FRFSVGGMTDVAEIK 582 >AY075423-1|AAL68239.1| 1006|Drosophila melanogaster LD43687p protein. Length = 1006 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFR 442 +LLAG GTGKT + I +L K +C ++ +KTE + ++ R Sbjct: 480 VLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLR 531 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMEN-FRRAIGLR 460 +LL GPPGTGKT + +A ++ + G E+ + I ++E + N F RA R Sbjct: 757 VLLYGPPGTGKTYLVSQLATSWNLRI--ISVKGPELLAKYIGQSEENVRNLFNRARSAR 813 >AJ243811-1|CAB51031.1| 1006|Drosophila melanogaster l(3)70Da protein. Length = 1006 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFR 442 +LLAG GTGKT + I +L K +C ++ +KTE + ++ R Sbjct: 480 VLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLR 531 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMEN-FRRAIGLR 460 +LL GPPGTGKT + +A ++ + G E+ + I ++E + N F RA R Sbjct: 757 VLLYGPPGTGKTYLVSQLATSWNLRI--ISVKGPELLAKYIGQSEENVRNLFNRARSAR 813 >AE014296-2356|AAF49760.1| 1006|Drosophila melanogaster CG6760-PA protein. Length = 1006 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFR 442 +LLAG GTGKT + I +L K +C ++ +KTE + ++ R Sbjct: 480 VLLAGASGTGKTVLVERILDQLSRKPDYCHFEFFHGSRSKGRKTESIQKDLR 531 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMEN-FRRAIGLR 460 +LL GPPGTGKT + +A ++ + G E+ + I ++E + N F RA R Sbjct: 757 VLLYGPPGTGKTYLVSQLATSWNLRI--ISVKGPELLAKYIGQSEENVRNLFNRARSAR 813 >U30502-1|AAA75044.1| 752|Drosophila melanogaster Drosophila N-ethylmaleimide-sensitivefusion protein 2 protein. Length = 752 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 259 KGILLYGPPGTGKTLMARQIGTMLNAREP 287 >U28836-1|AAC46844.1| 744|Drosophila melanogaster N-ethylmaleimide sensitive fusionprotein-2 protein. Length = 744 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 251 KGILLYGPPGTGKTLMARQIGTMLNAREP 279 >U09373-1|AAA83413.1| 745|Drosophila melanogaster N-ethylmaleimide-sensitive fusionprotein protein. Length = 745 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 254 KGILLYGPPGTGKTLMARQIGTMLNAREP 282 >BT023784-1|AAZ41793.1| 752|Drosophila melanogaster LD09622p protein. Length = 752 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 259 KGILLYGPPGTGKTLMARQIGTMLNAREP 287 >BT010259-1|AAQ23577.1| 745|Drosophila melanogaster RE33604p protein. Length = 745 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 254 KGILLYGPPGTGKTLMARQIGTMLNAREP 282 >AY094902-1|AAM11255.1| 751|Drosophila melanogaster RH08189p protein. Length = 751 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 R++LLAGP G+GK A+ AI E+G Sbjct: 488 RSILLAGPKGSGKKALLHAICTEVG 512 >AE014298-1870|AAF48244.2| 745|Drosophila melanogaster CG1618-PA protein. Length = 745 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 254 KGILLYGPPGTGKTLMARQIGTMLNAREP 282 >AE014297-1767|AAF54995.2| 752|Drosophila melanogaster CG33101-PA protein. Length = 752 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKVP 367 + +LL GPPGTGKT +A I L + P Sbjct: 259 KGILLYGPPGTGKTLMARQIGTMLNAREP 287 >AE014297-972|AAF54404.3| 793|Drosophila melanogaster CG16789-PA protein. Length = 793 Score = 32.3 bits (70), Expect = 0.63 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELG 355 R++LLAGP G+GK A+ AI E+G Sbjct: 530 RSILLAGPKGSGKKALLHAICTEVG 554 >BT001521-1|AAN71276.1| 297|Drosophila melanogaster LP12034p protein. Length = 297 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 R +L GPPG GKT +A AIA E Sbjct: 5 RGVLFYGPPGCGKTLLAKAIANE 27 >AY094968-1|AAM11321.1| 874|Drosophila melanogaster SD07712p protein. Length = 874 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKV 364 + LL GPPG GKT +A IA+ G V Sbjct: 302 KVALLCGPPGLGKTTLAHTIARHAGYNV 329 >AF287273-1|AAL02426.1| 993|Drosophila melanogaster DNA replication accessory factorCutlet protein. Length = 993 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKV 364 + LL GPPG GKT +A IA+ G V Sbjct: 421 KVALLCGPPGLGKTTLAHTIARHAGYNV 448 >AF124503-1|AAD31692.1| 520|Drosophila melanogaster DNA repair protein Rad17 protein. Length = 520 Score = 31.9 bits (69), Expect = 0.83 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 248 CRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELG 355 C +R KK + LL GP G GKT +A+E G Sbjct: 103 CEAVR-KKFPAQMCLLTGPTGAGKTTTLRVLAKEFG 137 >AF076839-1|AAC95521.1| 520|Drosophila melanogaster Rad17-like protein protein. Length = 520 Score = 31.9 bits (69), Expect = 0.83 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 248 CRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELG 355 C +R KK + LL GP G GKT +A+E G Sbjct: 103 CEAVR-KKFPAQMCLLTGPTGAGKTTTLRVLAKEFG 137 >AE014297-1884|AAF55086.2| 535|Drosophila melanogaster CG7825-PA protein. Length = 535 Score = 31.9 bits (69), Expect = 0.83 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 Query: 248 CRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELG 355 C +R KK + LL GP G GKT +A+E G Sbjct: 118 CEAVR-KKFPAQMCLLTGPTGAGKTTTLRVLAKEFG 152 >AE014134-661|AAN10380.2| 993|Drosophila melanogaster CG33122-PA protein. Length = 993 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQELGTKV 364 + LL GPPG GKT +A IA+ G V Sbjct: 421 KVALLCGPPGLGKTTLAHTIARHAGYNV 448 >AE013599-985|AAF58864.1| 297|Drosophila melanogaster CG2331-PB, isoform B protein. Length = 297 Score = 31.9 bits (69), Expect = 0.83 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQE 349 R +L GPPG GKT +A AIA E Sbjct: 5 RGVLFYGPPGCGKTLLAKAIANE 27 >AY069598-1|AAL39743.1| 353|Drosophila melanogaster LD35209p protein. Length = 353 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQEL 352 +LL GPPGTGKT+ LA ++++ Sbjct: 66 MLLYGPPGTGKTSTILAASRQI 87 >AE014298-2614|AAF48768.2| 353|Drosophila melanogaster CG8142-PA protein. Length = 353 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = +2 Query: 287 LLLAGPPGTGKTAIALAIAQEL 352 +LL GPPGTGKT+ LA ++++ Sbjct: 66 MLLYGPPGTGKTSTILAASRQI 87 >AY071291-1|AAL48913.1| 535|Drosophila melanogaster RE31829p protein. Length = 535 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 248 CRLIRSKKMAGRALLLAGPPGTGKTAIALAIAQELG 355 C +R KK + LL GP G GKT + +E G Sbjct: 118 CEAVR-KKFPAQMCLLTGPTGAGKTTTLRVLTKEFG 152 >AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin protein. Length = 16215 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +2 Query: 326 IALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVTE 502 + + I +E+ ++P V E TE KKT ++E IG++ E ++ E V E Sbjct: 13736 LKIKITEEVPQEIPILEEVSEEEVITETKKTAPVVEEKTYKIGIKETEPEKPAEAIVEE 13794 >AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC, isoform C protein. Length = 18074 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +2 Query: 326 IALAIAQELGTKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIRETKEVYEGEVTE 502 + + I +E+ ++P V E TE KKT ++E IG++ E ++ E V E Sbjct: 15595 LKIKITEEVPQEIPILEEVSEEEVITETKKTAPVVEEKTYKIGIKETEPEKPAEAIVEE 15653 >U43505-1|AAC46956.1| 460|Drosophila melanogaster DmORC5 protein. Length = 460 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +2 Query: 284 ALLLAGPPGTGKTAIALAIAQELGTK--VPFCPMVGSEVYSTEIKKTEVLMEN 436 A+ L G GTGKTA+ A +E G + V + E Y+T+I E+L+++ Sbjct: 36 AIYLFGHSGTGKTALTRAFLKECGKRQNVRTAHLNAIECYTTKI-MLEILLDS 87 >AY089590-1|AAL90328.1| 460|Drosophila melanogaster RE16687p protein. Length = 460 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +2 Query: 284 ALLLAGPPGTGKTAIALAIAQELGTK--VPFCPMVGSEVYSTEIKKTEVLMEN 436 A+ L G GTGKTA+ A +E G + V + E Y+T+I E+L+++ Sbjct: 36 AIYLFGHSGTGKTALTRAFLKECGKRQNVRTAHLNAIECYTTKI-MLEILLDS 87 >AE014134-2409|AAF53340.1| 460|Drosophila melanogaster CG7833-PA protein. Length = 460 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +2 Query: 284 ALLLAGPPGTGKTAIALAIAQELGTK--VPFCPMVGSEVYSTEIKKTEVLMEN 436 A+ L G GTGKTA+ A +E G + V + E Y+T+I E+L+++ Sbjct: 36 AIYLFGHSGTGKTALTRAFLKECGKRQNVRTAHLNAIECYTTKI-MLEILLDS 87 >AY089691-1|AAL90429.1| 431|Drosophila melanogaster RH68195p protein. Length = 431 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQEL 352 R LL GPPG GK++ A+A EL Sbjct: 225 RGYLLYGPPGCGKSSFITALAGEL 248 >AY075442-1|ABF85762.1| 437|Drosophila melanogaster RE04126p protein. Length = 437 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQEL 352 R LL GPPG GK++ A+A EL Sbjct: 225 RGYLLYGPPGCGKSSFITALAGEL 248 >AE014134-1783|AAN10723.1| 431|Drosophila melanogaster CG4908-PB, isoform B protein. Length = 431 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQEL 352 R LL GPPG GK++ A+A EL Sbjct: 225 RGYLLYGPPGCGKSSFITALAGEL 248 >AE014134-1782|AAF52876.1| 431|Drosophila melanogaster CG4908-PA, isoform A protein. Length = 431 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +2 Query: 281 RALLLAGPPGTGKTAIALAIAQEL 352 R LL GPPG GK++ A+A EL Sbjct: 225 RGYLLYGPPGCGKSSFITALAGEL 248 >BT009996-1|AAQ22465.1| 1483|Drosophila melanogaster RE35509p protein. Length = 1483 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQEL 352 L+ GPPGTGKT +A+ I + Sbjct: 833 LVVGPPGTGKTDVAVQIISNI 853 >AY129431-1|AAM76173.1| 1006|Drosophila melanogaster GM03621p protein. Length = 1006 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQEL 352 L+ GPPGTGKT +A+ I + Sbjct: 353 LVVGPPGTGKTDVAVQIISNI 373 >AY119579-1|AAM50233.1| 634|Drosophila melanogaster LD08709p protein. Length = 634 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +2 Query: 365 PFCPMVGSEVYSTEIKKTEVLMENFRRAI-----GLRIRETKEVYEGEVTELTLLKQKIL 529 P C + +E + ++ L+E FRR + ++ +E K+ Y E+ +QK+L Sbjct: 191 PICLKISNENTANLFREYSTLVERFRRVVTVDPLNMKGKEAKQKYWEELNGFDTFQQKLL 250 Query: 530 A 532 A Sbjct: 251 A 251 >AY118983-1|AAM50843.1| 872|Drosophila melanogaster LP02069p protein. Length = 872 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQEL 352 L+ GPPGTGKT +A+ I + Sbjct: 219 LVVGPPGTGKTDVAVQIISNI 239 >AE014297-1400|AAS65141.1| 1477|Drosophila melanogaster CG31368-PB, isoform B protein. Length = 1477 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQEL 352 L+ GPPGTGKT +A+ I + Sbjct: 827 LVVGPPGTGKTDVAVQIISNI 847 >AE014297-1399|AAF54713.3| 1480|Drosophila melanogaster CG31368-PA, isoform A protein. Length = 1480 Score = 29.1 bits (62), Expect = 5.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 290 LLAGPPGTGKTAIALAIAQEL 352 L+ GPPGTGKT +A+ I + Sbjct: 827 LVVGPPGTGKTDVAVQIISNI 847 >AE014296-984|AAF50757.1| 634|Drosophila melanogaster CG10583-PA protein. Length = 634 Score = 29.1 bits (62), Expect = 5.9 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = +2 Query: 365 PFCPMVGSEVYSTEIKKTEVLMENFRRAI-----GLRIRETKEVYEGEVTELTLLKQKIL 529 P C + +E + ++ L+E FRR + ++ +E K+ Y E+ +QK+L Sbjct: 191 PICLKISNENTANLFREYSTLVERFRRVVTVDPLNMKGKEAKQKYWEELNGFDTFQQKLL 250 Query: 530 A 532 A Sbjct: 251 A 251 >BT001876-1|AAN71648.1| 507|Drosophila melanogaster SD10626p protein. Length = 507 Score = 28.7 bits (61), Expect = 7.8 Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = -3 Query: 358 SSKFLSDGKSYSSFASTRR-PCQE*SSPGHFLTSYQSTTIPAASR-ADS*PTRPAAI*IG 185 SS++L + S+ TRR Q SP + + ++ AAS A P P A Sbjct: 194 SSRYLYHSQFNSNSPQTRRFTAQRDGSPAYAASVAAASAAAAASAVAPIAPLAPLASIAS 253 Query: 184 TPFSSNPKPF 155 PF++ P PF Sbjct: 254 PPFAAQPPPF 263 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,764,396 Number of Sequences: 53049 Number of extensions: 640537 Number of successful extensions: 2000 Number of sequences better than 10.0: 137 Number of HSP's better than 10.0 without gapping: 1877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2000 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2971922400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -