BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060451.seq (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0138 + 17093196-17093325,17095704-17095804,17096224-170962... 37 0.017 07_01_0479 + 3606663-3607448 36 0.023 07_03_1067 + 23728642-23728690,23728832-23729010 36 0.030 03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647,132... 36 0.030 01_02_0007 + 10132380-10133201 35 0.069 04_03_0689 + 18746735-18748296,18748401-18748485 34 0.12 03_06_0471 + 34169562-34169892,34170121-34170347 34 0.12 05_05_0173 + 22956927-22958615 33 0.16 04_03_0742 + 19200045-19200053,19200158-19200437,19201331-192015... 33 0.21 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 33 0.28 08_01_0178 - 1509100-1511214 32 0.37 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 32 0.49 09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801,116... 32 0.49 05_01_0142 - 940421-940701,941262-941574 32 0.49 11_06_0610 - 25449085-25453284 31 0.64 07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404... 31 0.64 05_04_0035 + 17378541-17381276 31 0.64 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 31 0.85 02_02_0119 + 6978697-6979045,6979519-6979581,6979757-6979866,697... 31 0.85 12_02_0297 + 17029850-17030047,17030814-17030973,17031666-170317... 31 1.1 04_04_0435 - 25170348-25170593,25170989-25171189,25171580-251717... 31 1.1 04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 31 1.1 12_02_1174 - 26696869-26698191 30 1.5 12_02_0046 + 12830974-12832386 30 1.5 09_04_0506 - 18188785-18190599 30 1.5 07_03_1160 - 24430240-24431268 30 1.5 05_02_0124 + 6849034-6851502 30 1.5 02_05_0970 - 33179180-33179210,33179297-33179441,33180307-331803... 30 1.5 02_05_0700 + 31018480-31019832 30 1.5 08_02_0163 + 13470178-13470335,13470635-13470656,13470885-134710... 30 2.0 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 30 2.0 06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 29 2.6 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 29 2.6 12_02_0702 - 22278513-22278751,22279054-22279889,22279932-222799... 29 3.4 09_04_0424 + 17444261-17444665,17445974-17446367,17447367-174474... 29 3.4 09_04_0192 + 15478270-15480257,15480358-15480640,15480727-15481116 29 3.4 07_03_1546 + 27602598-27602917,27602995-27603052,27603130-276032... 29 3.4 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 29 3.4 01_01_0907 + 7128397-7128497,7129944-7130022,7130470-7130568,713... 29 3.4 11_01_0566 + 4466318-4466695,4466736-4466909,4466941-4467038,446... 29 4.5 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 4.5 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 29 4.5 06_03_1089 - 27521291-27522124 29 4.5 02_05_0256 + 27201483-27202499,27203297-27203375,27204617-272049... 29 4.5 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 29 4.5 07_03_1176 + 24567720-24570932 28 6.0 06_03_0112 + 16781770-16782020,16782032-16782764 28 6.0 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 28 6.0 03_05_1125 + 30576951-30577010,30577163-30577285,30577393-305775... 28 6.0 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 28 6.0 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 28 7.9 08_01_0080 + 566509-566746,566904-567151,567347-567532,567639-56... 28 7.9 06_03_0874 - 25580417-25580419,25580504-25580604,25580828-255814... 28 7.9 06_02_0120 + 12055076-12055175,12055322-12055725 28 7.9 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 28 7.9 03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 28 7.9 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 28 7.9 01_03_0145 - 13116302-13116958,13117365-13117430,13117786-131180... 28 7.9 01_01_0387 + 2999222-2999495,2999834-2999934 28 7.9 >06_03_0138 + 17093196-17093325,17095704-17095804,17096224-17096292, 17096403-17097650,17097763-17097871,17099459-17099655, 17099732-17099842,17099927-17100079 Length = 705 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/58 (37%), Positives = 29/58 (50%) Frame = +1 Query: 304 AQPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQ 477 + P+P +G P Y PGF Y PSG+P +QQP P + +PQ LQQ Sbjct: 198 SSPMPSSANGAGLTMPPMYWPGF---YTPPSGFPH--LQQPPFLRPPHGLTIPQALQQ 250 >07_01_0479 + 3606663-3607448 Length = 261 Score = 36.3 bits (80), Expect = 0.023 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +1 Query: 337 QPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQ 465 +PG G PG PG P P P PGPQ PG N PQ Sbjct: 221 RPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPG--QNPPQ 261 Score = 35.5 bits (78), Expect = 0.040 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGY-QPGFAPGYPQPSGYPVPVMQQPGPQAP 441 Q PGM G PG +PG P F PG P P P QQPG P Sbjct: 219 QVRPGMPGGPPPGMRPGMPPPPFRPGMPPPP----PGPQQPGQNPP 260 >07_03_1067 + 23728642-23728690,23728832-23729010 Length = 75 Score = 35.9 bits (79), Expect = 0.030 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQP-GYQP--GFAP-GYPQPSGYPVPVMQQPGPQ 435 Q PG PG+ P GY P G+ P GYP GYP P Q P Q Sbjct: 16 QGYPGKDGYPPPGYPPAGYPPAQGYPPAGYPPQQGYPPPYAQPPPQQ 62 Score = 31.9 bits (69), Expect = 0.49 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 8/48 (16%) Frame = +1 Query: 331 GFQP-GFQP--GYQP-GFAP--GYPQPSGYPVPVMQQ--PGPQAPGGW 450 G+ P G+ P GY P G+ P GYP P P P QQ GP GW Sbjct: 28 GYPPAGYPPAQGYPPAGYPPQQGYPPPYAQPPPQQQQHSSGPSFMEGW 75 >03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647, 1327482-1327530,1328834-1328855,1328969-1329071 Length = 241 Score = 35.9 bits (79), Expect = 0.030 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 5/59 (8%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQP--GYQPGFAP--GYPQPSGYPVP-VMQQPGPQAPGGWMNMPQG 468 QP G +G P P GY P P GYPQ YP P PG P G PQG Sbjct: 179 QPAYGQPYGGYPPAPPAQGYPPAAYPPAGYPQGGAYPPPGSYPPPGSYPPQGSYPPPQG 237 >01_02_0007 + 10132380-10133201 Length = 273 Score = 34.7 bits (76), Expect = 0.069 Identities = 21/44 (47%), Positives = 23/44 (52%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 PLPG Q QPG QP P P P P+ P+P QP P AP Sbjct: 98 PLPGPQPLPQPGPQPNPNPQPLP-QPNPNPQPLP---QPDPNAP 137 Score = 33.5 bits (73), Expect = 0.16 Identities = 22/44 (50%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQ-QPGPQ 435 QPLP Q QP PG QP PG PQP+ P P+ Q P PQ Sbjct: 85 QPLPQPQPQPQPLPLPGPQPLPQPG-PQPNPNPQPLPQPNPNPQ 127 >04_03_0689 + 18746735-18748296,18748401-18748485 Length = 548 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +1 Query: 379 GYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRFGIPF 504 G P P+ P P + P PQ GG P G + PS G PF Sbjct: 5 GNPNPNSTPTPQPRPPQPQQQGGSPATPLGHLRPPSLAGSPF 46 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = +1 Query: 343 GFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRFGIP 501 GF Y G+ YP GYP Q P PGG+ + P G Q P G P Sbjct: 16 GFHGAYPSGYPGAYPLMQGYPNSPGQYP---TPGGYPSAPPG--QYPPAGGYP 63 Score = 31.9 bits (69), Expect = 0.49 Identities = 20/45 (44%), Positives = 23/45 (51%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGW 450 PG Q + P P Q G+ PG PSGYP QQPG P G+ Sbjct: 63 PGAQ--YPPSGYPPSQGGYPPGAYPPSGYP----QQPG-YPPAGY 100 Score = 30.3 bits (65), Expect = 1.5 Identities = 25/65 (38%), Positives = 28/65 (43%), Gaps = 7/65 (10%) Frame = +1 Query: 328 HGFQPGFQPGYQP---GF--APG-YPQPSGYP-VPVMQQPGPQAPGGWMNMPQGLQQLPS 486 HG P PG P G+ +PG YP P GYP P Q P G P G PS Sbjct: 18 HGAYPSGYPGAYPLMQGYPNSPGQYPTPGGYPSAPPGQYPPAGGYPGAQYPPSGYP--PS 75 Query: 487 RFGIP 501 + G P Sbjct: 76 QGGYP 80 >05_05_0173 + 22956927-22958615 Length = 562 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +2 Query: 152 PTPYSPNFPASH-GYVPPPEGEKPNESYP-MHPQSGFLAHHPLLCHTPAYILG 304 P PY P+ P +H YVPPP P E+ P + F HP L P+ +LG Sbjct: 83 PEPYDPSAPEAHPPYVPPP--VPPPEAIPELADDLEFGFSHPPLLLRPSELLG 133 >04_03_0742 + 19200045-19200053,19200158-19200437,19201331-19201545, 19201705-19201792,19202277-19202842 Length = 385 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAPGYP----QPSGYPVPVMQQPGPQA 438 PG + + P + P Y P + P YP PS +P + P A Sbjct: 337 PGPGYAYPPPYPPSYPPPYQPSYPPYPSHPSHHPSQIFSDENPNA 381 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 32.7 bits (71), Expect = 0.28 Identities = 21/53 (39%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAPGYPQP--SGYPVPVMQQPGPQAPGGWMNMPQG 468 PG Q G PG+ G P + G P P +G PV PG Q GG + QG Sbjct: 326 PGYQGG-GPGYHGGNPPPYQAGNPPPYQAGNPVFAGGAPGYQGQGGNPSYQQG 377 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 313 LPGMQHGFQPGFQPGYQPGFAPGYPQPSGYP--VPVMQQPGPQAPGG 447 +PG Q G PG+Q G Q P P PS Y P Q GP GG Sbjct: 293 VPGYQ-GRAPGYQGGNQEYRGPPPPPPSAYQGNNPGYQGGGPGYHGG 338 >08_01_0178 - 1509100-1511214 Length = 704 Score = 32.3 bits (70), Expect = 0.37 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 Query: 252 ASWPTTHSYATPRPTSWGTTPSGHAAWVPARISTWLSTRIC 374 A W S P+P TTP G P R+ W S C Sbjct: 47 ARWTNAPSNPPPQPAGGSTTPFGQTTGFPMRVRPWSSCDKC 87 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 31.9 bits (69), Expect = 0.49 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAPGYPQPSGYP 405 PG Q G P +Q G PG+APGY G P Sbjct: 342 PGYQGGNPPPYQGG-NPGYAPGYHGQGGNP 370 >09_01_0079 - 1159963-1160211,1160303-1160509,1160631-1160801, 1161732-1161869,1162184-1162273,1162354-1162431, 1162510-1163166,1163245-1163363,1164305-1164584 Length = 662 Score = 31.9 bits (69), Expect = 0.49 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 4/61 (6%) Frame = +1 Query: 307 QPLPGM---QHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQ-PGPQAPGGWMNMPQGLQ 474 QP P Q GF GFQ PG PG + +P++QQ PQ P G G+Q Sbjct: 445 QPPPAFINTQPGF--GFQQPLMPGMRPGAGPMPNFIMPMVQQGQQPQRPAGRRAGAGGMQ 502 Query: 475 Q 477 Q Sbjct: 503 Q 503 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 31.9 bits (69), Expect = 0.49 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +1 Query: 304 AQPLPGMQHGFQPGFQPGYQPGFAP--GYPQPSGYPVP-VMQQPGPQAPGGW 450 A P P + PG P + P GYPQP GYP P Q G P G+ Sbjct: 46 AYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGYPPPGGYPQHGGYPPAGY 97 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/46 (45%), Positives = 24/46 (52%), Gaps = 5/46 (10%) Frame = +1 Query: 328 HGFQP--GFQP-GYQPGFAPG-YPQPSG-YPVPVMQQPGPQAPGGW 450 HG+ P G+ P GY P PG YP P G YP P P P PG + Sbjct: 27 HGYPPHQGYPPQGYPP--PPGAYPPPPGAYPPPPGAYPPP--PGAY 68 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 131 ELTMSHKPTPYSPNFPASHGYVPPPEGEKPNE 226 E + +++ P +P+ P SHG PPPE E P E Sbjct: 440 EKSPAYEEPPAAPSTPTSHGP-PPPEEESPEE 470 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 164 SPNFPASHGYVP-PPEGEKPNESYPMHPQS 250 SP PA G+ P PPE P+E P P+S Sbjct: 627 SPPPPAPEGHTPSPPESTPPSEKSPPTPES 656 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 152 PTPYSPNFPASHGYVPPPEGEKP 220 PT YSP PA+ PPPEG+ P Sbjct: 536 PTEYSP--PATPESSPPPEGKSP 556 >07_03_1713 + 28939446-28939574,28939674-28940231,28940338-28940460, 28940676-28940912 Length = 348 Score = 31.5 bits (68), Expect = 0.64 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = +2 Query: 152 PTPYSPNFPASHG---YVPPPEGEKPNESYPMHPQSGFLAHHPLLCH-TPAYILGHNP 313 P Y+P P ++G Y PPP +P Y HP F P H P Y G+ P Sbjct: 121 PEAYAPPPPPAYGHQAYPPPPPNREPGHGY--HPAPAFYPPQPPPSHDEPGY--GYRP 174 >05_04_0035 + 17378541-17381276 Length = 911 Score = 31.5 bits (68), Expect = 0.64 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 361 QPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRFGIP 501 QPG+ +P +G+ P +QQP P + Q ++FG P Sbjct: 746 QPGYGTSHPWHTGFNAPQVQQPSYGGPQSSQHAVGSTQPPQAQFGAP 792 >08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 Length = 145 Score = 31.1 bits (67), Expect = 0.85 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 161 YSPN-FPASHGYVPPPEGEKPNESYPMHP 244 Y P +P+SHG PPP+G P P P Sbjct: 60 YPPQGYPSSHGVYPPPQGPYPPPHQPPPP 88 >02_02_0119 + 6978697-6979045,6979519-6979581,6979757-6979866, 6979969-6980154,6980266-6980361,6980493-6980564, 6980798-6980909,6982448-6982534,6982680-6983872 Length = 755 Score = 31.1 bits (67), Expect = 0.85 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 328 HGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGG 447 HG P QPGY GY QP YP Q PQ P G Sbjct: 394 HGGAPMQQPGY------GYMQPGAYPGAPPQYGAPQQPYG 427 Score = 28.7 bits (61), Expect = 4.5 Identities = 24/68 (35%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYP---VPVMQQPGP-QAPGGWMNMPQGLQQ 477 P P +G QP Q GY G PQ P P Q P P APGG+ G Q Sbjct: 610 PPPQTGYGTQPQPQGGYSQGSYGAPPQGQKAPPNTSPYGQAPPPGSAPGGYGQ--YGYSQ 667 Query: 478 LPSRFGIP 501 +G P Sbjct: 668 NQQGYGAP 675 >12_02_0297 + 17029850-17030047,17030814-17030973,17031666-17031782, 17032145-17032575 Length = 301 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 215 KPNESYPMHPQSGFLAHHPLLCHTPAYILGHNPFRACSMGSS 340 KP +S P +PQ+ H CH PA++ FRA + S+ Sbjct: 42 KPTKSLPKNPQTFQRPIHTTQCHVPAFV--RTGFRAMRVSSA 81 >04_04_0435 - 25170348-25170593,25170989-25171189,25171580-25171756, 25172284-25172418,25173131-25173262,25173292-25173369, 25173452-25174108,25174210-25174328,25175897-25176173 Length = 673 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +1 Query: 325 QHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 Q GF GFQ PG PG Y VPV+QQ G Q P Sbjct: 466 QPGF--GFQQQLVPGMRPGGAHMPNYFVPVVQQ-GQQGP 501 >04_01_0453 + 5869627-5870232,5870383-5870897,5870964-5871600 Length = 585 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +1 Query: 319 GMQHGFQPGFQPGYQPGFAP-GYPQPSGYPVPVMQQPGPQ----APGGWMNMPQG 468 G GF PGF G Q G AP G + G P +PGP+ GGW N G Sbjct: 19 GFARGFHPGFVVGNQHGGAPGGRGRGRGRGRPT-GRPGPRHEFSHAGGWNNFGGG 72 >12_02_1174 - 26696869-26698191 Length = 440 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 QP P +Q P P P P QP P P + P P P Sbjct: 180 QPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPP 224 >12_02_0046 + 12830974-12832386 Length = 470 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 155 TPYSPNFPASHGYVPPPEGEKPNESYPMHP 244 TP SP+ P + PPP + P +SY + P Sbjct: 342 TPPSPHAPRHDPFEPPPSPDPPIQSYAIDP 371 >09_04_0506 - 18188785-18190599 Length = 604 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +1 Query: 343 GF-QPGYQPGFAPGYPQPSGYPVPVMQQPGP-QAPGGWMNMPQGLQQLPSRFGIP 501 GF Q + P P PQ P P+ QQP P QAP Q QQL + +P Sbjct: 43 GFLQSSHPPPQPPPPPQQQQQPPPISQQPPPLQAPPPPPQQQQQQQQLQAPPSLP 97 >07_03_1160 - 24430240-24431268 Length = 342 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 QP PG+ P P +P P P+P G P+P + QP P P Sbjct: 67 QPTPGVPPLPNPDVPPMNKPDVPP-MPKPDGPPIPPV-QPCPDQP 109 >05_02_0124 + 6849034-6851502 Length = 822 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 197 PPPEGEKPNESYPMHPQSGFLAHHPLL 277 PPP PN ++P +P+S LA HP L Sbjct: 19 PPPPPSPPNSTFPRYPKS--LAAHPAL 43 >02_05_0970 - 33179180-33179210,33179297-33179441,33180307-33180362, 33180650-33180691,33180814-33180866,33181059-33181490, 33181630-33181707,33181785-33181870,33183588-33183689, 33183754-33183960,33184976-33185336,33185463-33185626, 33185709-33185817,33186468-33186485 Length = 627 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 352 PGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWM--NMPQGLQQLP 483 P F+ SG P +QQPG PG + N+P G+ Q+P Sbjct: 54 PNMPGSFSQRNAAMSGLPSSGVQQPGGSMPGRFASNNLPVGMSQIP 99 >02_05_0700 + 31018480-31019832 Length = 450 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQ-PGFA-PGYP----QPSGYPVPVMQQPGPQAPG 444 QPLPG QP PG PG + PG P +P G P+P PG PG Sbjct: 54 QPLPGQSLPGQP--LPGQPLPGQSLPGQPLVGEKPPGQPLPGQPLPGQSLPG 103 >08_02_0163 + 13470178-13470335,13470635-13470656,13470885-13471055, 13471157-13471363,13471458-13471700 Length = 266 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/58 (34%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQ-PGPQAPGGWMNMPQGLQQ 477 QP+PG GFQ PG P + +P++QQ PQ P G G+QQ Sbjct: 58 QPMPGF------GFQQHLIPGMRPSVGPIPNFVMPMVQQGQQPQRPAGRRAGTGGIQQ 109 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/69 (27%), Positives = 25/69 (36%) Frame = +2 Query: 107 IYEKGYETELTMSHKPTPYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHT 286 ++++ E P Y PN YVPPP G P P A P Sbjct: 381 VHQQPEEVAAPYGPPPQSYPPNVRLPSPYVPPPSGPAPPFYGPNPGMYEPPAVRPNSGPP 440 Query: 287 PAYILGHNP 313 P+Y G+ P Sbjct: 441 PSYNTGYKP 449 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 331 GFQPGFQPGYQPGFAPGYPQPSGY 402 G P + GY+P G+P+P GY Sbjct: 438 GPPPSYNTGYKPQGGGGFPEPYGY 461 >06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 Length = 627 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +2 Query: 146 HKPTPYSPNFPASHGY---VPPPEGEKPNESYPMHPQSGFLAHHPLLCHTP 289 H P PY+ P Y +PPP+ ++ P H Q A H + +P Sbjct: 28 HHPPPYAAPLPQYAPYARGMPPPQAQQLYSHLPPHQQPPHFAAHAMPSPSP 78 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 29.5 bits (63), Expect = 2.6 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 11/65 (16%) Frame = +1 Query: 304 AQPLPGMQHGFQ----PGFQPGYQPGFAPGYPQPS------GYPVPVMQQPGPQAP-GGW 450 A PL G HG Q PG PG QP PG P PS MQQ PQ P Sbjct: 488 AMPLDGSDHGEQRPSIPGLPPG-QPPLPPG-PHPSLLAGGQQQQYQQMQQQHPQFPRPPP 545 Query: 451 MNMPQ 465 NMPQ Sbjct: 546 PNMPQ 550 >12_02_0702 - 22278513-22278751,22279054-22279889,22279932-22279975, 22280350-22280463 Length = 410 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 222 MKVTPCILKAASWPTTHSYATPRPTSWGT-TPSGHAAWVPARIS 350 ++ T ILKA+S PT + P PT T P+ + WV A S Sbjct: 133 IRTTTAILKASSSPTPMAPPPPTPTKCLTKCPNNNFTWVMANSS 176 >09_04_0424 + 17444261-17444665,17445974-17446367,17447367-17447425, 17447507-17447637,17447737-17447833,17447936-17448100 Length = 416 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 334 FQPGFQPGYQPGFAPGYPQPSGYPVPV---MQQPGPQAPGG 447 F P F P + G P PQP P PV M P P A GG Sbjct: 63 FAPHFVPFHAVG-PPPPPQPRAAPPPVAVAMGSPAPHAQGG 102 >09_04_0192 + 15478270-15480257,15480358-15480640,15480727-15481116 Length = 886 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 5/59 (8%) Frame = -2 Query: 382 IQEQILVDSQVEILAGTHAACPEG-----VVPQDVGRGVA*EWVVGQEAALRMHGVTFI 221 +Q + L+D +LA A G V+PQ V +GVA E +V AA R + F+ Sbjct: 725 LQAKELLDHLATVLASEPVAVRSGYKIVEVIPQGVSKGVAAECIVSAMAARRGGALGFV 783 >07_03_1546 + 27602598-27602917,27602995-27603052,27603130-27603252, 27603896-27603992,27604095-27604131,27604244-27604349, 27604547-27604604,27604705-27604802,27604911-27605030, 27605622-27605667,27606336-27606522,27606747-27607263, 27607361-27607453,27608101-27608286,27608364-27608574, 27609263-27609387,27609518-27609664,27610114-27610236, 27610445-27610799,27611076-27611305,27611785-27611877 Length = 1109 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = +1 Query: 334 FQPGFQPGY--QPGFAPGYP----QPSGYPVPVMQQPGPQA 438 F P PG+ +PG +P P Q G P PV+ P P A Sbjct: 951 FMPSNNPGFVQRPGLSPVQPSSPTQAQGQPQPVVAPPAPPA 991 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.1 bits (62), Expect = 3.4 Identities = 24/62 (38%), Positives = 27/62 (43%), Gaps = 9/62 (14%) Frame = +1 Query: 343 GFQPGYQPG-FAP---GYPQP-SGYPVPV----MQQPGPQAPGGWMNMPQGLQQLPSRFG 495 G P PG +AP G P P + YP P M P P APG P G+Q P Sbjct: 421 GAPPPPPPGSYAPVPWGQPPPYASYPPPPPGSSMYNPPPPAPGQATPPPYGVQYAPPPAP 480 Query: 496 IP 501 IP Sbjct: 481 IP 482 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/66 (30%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = +1 Query: 307 QPLPGMQHGFQ--PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQL 480 QP+P +G P P Y P P Y S YP QP P P + Q L Sbjct: 510 QPVPAPVYGTSGAPNAPPMYPP---PPYGYASYYPSVTPVQPPPPPPPAGADPSQSLANA 566 Query: 481 PSRFGI 498 P + + Sbjct: 567 PGQLTV 572 >01_01_0907 + 7128397-7128497,7129944-7130022,7130470-7130568, 7130654-7130767,7130960-7131102,7131716-7131797, 7132425-7132510,7132879-7133112,7134684-7135162, 7135309-7136027 Length = 711 Score = 29.1 bits (62), Expect = 3.4 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 3/63 (4%) Frame = +1 Query: 313 LPGMQHGFQPGFQPGYQPGFAP--GYPQPSGYP-VPVMQQPGPQAPGGWMNMPQGLQQLP 483 +PGMQ PG QP PG P Y QP P + P P+ G M+ + +QQ Sbjct: 578 MPGMQF---PGMQPSPMPGAQPVMMYAQPMMMPGMQFAAMPQPRMYGPQMSQYRLVQQQA 634 Query: 484 SRF 492 +++ Sbjct: 635 AQY 637 >11_01_0566 + 4466318-4466695,4466736-4466909,4466941-4467038, 4467211-4467346 Length = 261 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 225 KVTPCILKAASWPTTHSYATPRPTSWGTTPSGHAAWVPARISTWLS 362 K T ILKAAS PT + P PT T S A ++T ++ Sbjct: 51 KATSTILKAASSPTPMAPPPPTPTKCSTICSSSDAKADITVATMVT 96 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPG 444 QP P +G P QP Y P P G P P + P P PG Sbjct: 21 QPPPMNPYGPPPPQQPAYGH-----MPPPQGAPPPFLAPPPPPPPG 61 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +2 Query: 146 HKPTPY--SPNFPASHG--YVPPPEGEKPNESYPMHP 244 H P P+ P+ P HG Y PP PN +Y + P Sbjct: 1174 HPPGPHFSGPSVPPHHGNNYHQPPSVPPPNNAYHLQP 1210 >06_03_1089 - 27521291-27522124 Length = 277 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 164 SPNFPA-SHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCH 283 SP PA S PPP E+ + PM P+ F HP H Sbjct: 171 SPASPAASPTPPPPPPTERSADVRPMPPEGHFFIPHPHFMH 211 >02_05_0256 + 27201483-27202499,27203297-27203375,27204617-27204946, 27205029-27205198 Length = 531 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +3 Query: 219 QMKVTPCILKAASWPTTHSYATPRPTSWGTTPSGHAAWVPARISTWLS 362 ++ TPC + + + TT S ATPR T PS W A + W+S Sbjct: 223 EVAATPCWMPSPARFTTPS-ATPRHHIITTKPSSLRIWWVADLMRWMS 269 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 334 FQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQ 435 F G +PG +P P P+P P P +PGP+ Sbjct: 153 FHHGPKPGPKPKPKPSPPKPKPGPKPKPPKPGPK 186 >07_03_1176 + 24567720-24570932 Length = 1070 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -1 Query: 683 LKXSRSKFFWCQQSLSLNPHNKTFXTQHCSINCVICCLS-RPXQKLLIIQL 534 L+ R++ F+ + PH+ T H ++ C + LS RP K ++ +L Sbjct: 1009 LRQGRAREFFIDGLWDVGPHDDLVETLHLAVMCTVDSLSVRPTMKQVVQRL 1059 >06_03_0112 + 16781770-16782020,16782032-16782764 Length = 327 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 131 ELTMSHKPTPYSPNFP--ASHGYVPPPEGEKPNESYPMHPQSGFLAHHP 271 +L++ P + P F AS PPP G PN + HPQ + P Sbjct: 191 QLSIPRAPQVHQPIFDQGASTSAAPPPHGYDPNTFF--HPQYAYFRIQP 237 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 28.3 bits (60), Expect = 6.0 Identities = 23/68 (33%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMP--QGLQQLP 483 P P G P P G G P P G P P M P PGG P +GL P Sbjct: 1174 PPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMP---PGVPGGPPPPPGGRGLPAPP 1230 Query: 484 SRFGIPFH 507 G+ H Sbjct: 1231 GGRGVVGH 1238 >03_05_1125 + 30576951-30577010,30577163-30577285,30577393-30577552, 30577635-30577702,30577928-30578473,30578725-30579312, 30579392-30579604,30580227-30580388 Length = 639 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +1 Query: 358 YQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPS 486 Y G+AP P PSG PVP + G P Q P+ Sbjct: 145 YGYGYAPYGPYPSGSPVPTVGHDGQSYGAQHYQYPGQYYQQPA 187 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 28.3 bits (60), Expect = 6.0 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +1 Query: 337 QPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGL 471 +PGF P P P P PVPVM G P W +PQ L Sbjct: 23 RPGFPVAPPPPMGPPPPPPMP-PVPVMYLRGVPPPPPW--LPQHL 64 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 152 PTPYSPNFPASHGYVPPPEGEKPNESYPMH 241 PTP +PN S PPP P + PMH Sbjct: 43 PTPLTPNPNPSPTLPPPPMSTPPVVAPPMH 72 >08_01_0080 + 566509-566746,566904-567151,567347-567532,567639-567734, 567836-567907,567990-568106,570531-571676 Length = 700 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPV--PVMQQPGPQAPGGWMNMPQGLQQ 477 QP G Q G+ P P +P PG P G P Q P P + G P Q Sbjct: 477 QPPAGPQQGYPPQQDPYARPYGGPGQWAPRGAPAGDGTYQAPPPTSYGPPSQQPPAYGQ 535 >06_03_0874 - 25580417-25580419,25580504-25580604,25580828-25581411, 25581523-25581594,25581667-25581793,25583412-25583516, 25583643-25583676 Length = 341 Score = 27.9 bits (59), Expect = 7.9 Identities = 25/72 (34%), Positives = 28/72 (38%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPS 486 QP P + + P QP QP P PQ YP QP P P G P Q Sbjct: 251 QPQP-QRETYPP--QPQVQP--YPPKPQGQPYPPQPQGQPYPPQPYGQTYPPPPKGQPTY 305 Query: 487 RFGIPFHVXQLI 522 G P + QLI Sbjct: 306 PPGYPAFIIQLI 317 >06_02_0120 + 12055076-12055175,12055322-12055725 Length = 167 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +1 Query: 319 GMQHG---FQPGFQPGY-QPGFAPGYPQPSGY 402 G +HG QP + GY QPG+ GY QP GY Sbjct: 58 GYEHGGGYSQPRYGGGYGQPGYGGGYGQP-GY 88 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = +1 Query: 304 AQPLPGMQHGFQPGF-----QPGYQPGFAPGY 384 +QP G +G QPG+ QPGY G+ PGY Sbjct: 66 SQPRYGGGYG-QPGYGGGYGQPGYGSGYGPGY 96 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +1 Query: 340 PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLP 483 PG P G P P P P P Q P P P M MP + P Sbjct: 254 PGTLPNGSGG--PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 >03_02_0402 - 8151448-8151669,8151916-8152417,8154537-8155105 Length = 430 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 346 FQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 F P P PG+P SG P P QP P Sbjct: 113 FPPSAHPQHYPGWPGVSGRPHPCGLQPAMPTP 144 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +2 Query: 119 GYETELTMSHKPTPYSPNFPASHGY-VPPPEGEKPNESYPMHPQSGFLAHHPLLCHT 286 G+ E + P P P P+S Y PP + +P+H S P HT Sbjct: 176 GWHPEADVPPPPPPLEPPVPSSSDYHAKPPLQAVKSSLFPIHSGSPAATARPPSSHT 232 >01_03_0145 - 13116302-13116958,13117365-13117430,13117786-13118065, 13118283-13119028 Length = 582 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 98 RQLIYEKGYETELTMSHKPTPYSPNFPASHGYVPP 202 R+LI ++ + S +PYSPNFP+S + P Sbjct: 280 RELIIFGNNQSPSSSSPALSPYSPNFPSSPNPISP 314 >01_01_0387 + 2999222-2999495,2999834-2999934 Length = 124 Score = 27.9 bits (59), Expect = 7.9 Identities = 19/66 (28%), Positives = 23/66 (34%) Frame = +2 Query: 110 YEKGYETELTMSHKPTPYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHTP 289 YE+GY H + +P HG PP G P Y A H H Sbjct: 39 YEQGYGGHGYPPHAGAAHGA-YPPQHGAYPPQHGAYPGHGYVPGAYPSNAAPHG--GHMG 95 Query: 290 AYILGH 307 +Y GH Sbjct: 96 SYHTGH 101 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,754,067 Number of Sequences: 37544 Number of extensions: 398116 Number of successful extensions: 1964 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1917 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -