BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060451.seq (683 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g21740.1 68414.m02721 expressed protein contains Pfam domains... 42 3e-04 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 38 0.008 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 37 0.011 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 35 0.044 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 35 0.044 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 35 0.058 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 34 0.076 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 33 0.13 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 33 0.18 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 33 0.23 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 32 0.31 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 32 0.31 At1g54830.3 68414.m06253 CCAAT-box binding transcription factor ... 32 0.41 At1g54830.2 68414.m06252 CCAAT-box binding transcription factor ... 32 0.41 At1g54830.1 68414.m06251 CCAAT-box binding transcription factor ... 32 0.41 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 0.54 At1g08970.4 68414.m01000 CCAAT-box binding transcription factor ... 31 0.54 At1g08970.3 68414.m00999 CCAAT-box binding transcription factor ... 31 0.54 At1g08970.2 68414.m00998 CCAAT-box binding transcription factor ... 31 0.54 At1g08970.1 68414.m00997 CCAAT-box binding transcription factor ... 31 0.54 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 31 0.71 At1g09070.1 68414.m01012 C2 domain-containing protein / src2-lik... 31 0.71 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 31 0.94 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 31 0.94 At5g67600.1 68418.m08524 expressed protein 30 1.2 At2g13550.1 68415.m01494 expressed protein 30 1.2 At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-conta... 30 1.2 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 29 2.2 At5g44780.1 68418.m05488 expressed protein low similarity to SP|... 29 2.9 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 29 2.9 At4g20020.2 68417.m02930 expressed protein 29 2.9 At4g20020.1 68417.m02931 expressed protein 29 2.9 At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family... 29 2.9 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 3.8 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 3.8 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 29 3.8 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 28 5.0 At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family... 28 5.0 At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family... 28 5.0 At3g07660.1 68416.m00918 expressed protein 28 5.0 At2g34720.1 68415.m04264 CCAAT-binding transcription factor (CBF... 28 5.0 At2g16470.1 68415.m01887 zinc finger (CCCH-type) family protein ... 28 5.0 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 28 5.0 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 28 6.6 At2g39050.1 68415.m04800 hydroxyproline-rich glycoprotein family... 28 6.6 At1g77500.1 68414.m09025 expressed protein contains Pfam domains... 28 6.6 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 28 6.6 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 28 6.6 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 28 6.6 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 27 8.8 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 27 8.8 At5g01160.1 68418.m00020 e-cadherin binding protein-related cont... 27 8.8 At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa... 27 8.8 At2g27260.1 68415.m03276 expressed protein 27 8.8 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 27 8.8 At1g26150.1 68414.m03192 protein kinase family protein similar t... 27 8.8 At1g19310.1 68414.m02401 zinc finger (C3HC4-type RING finger) fa... 27 8.8 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 27 8.8 >At1g21740.1 68414.m02721 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 953 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 325 QHGFQPGFQPGYQPGFAPGYPQPSGY 402 Q G+Q G+Q GYQPGF PGY GY Sbjct: 158 QPGYQSGYQSGYQPGFTPGYQYQPGY 183 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPG--FAPGYPQPSGYPV 408 PG Q G+Q G+QPG+ PG + PGY YPV Sbjct: 159 PGYQSGYQSGYQPGFTPGYQYQPGYSAGYQYPV 191 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 37.5 bits (83), Expect = 0.008 Identities = 24/64 (37%), Positives = 32/64 (50%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSR 489 P+PG GF+ F PG PG P G+ +P P P +PGG +P G+ +P Sbjct: 68 PIPGSP-GFRLPFPFPSSPGGNPGIPGSPGFRLPF---PFPSSPGGNPGIP-GIPGIPGL 122 Query: 490 FGIP 501 GIP Sbjct: 123 PGIP 126 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 37.1 bits (82), Expect = 0.011 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPG-YPQPSGYPVPVMQQPGPQA--PGGWMNMPQGLQQ 477 P + +GFQP F PG +PG PG + P YP+ Q GP+ G N+ Q +QQ Sbjct: 459 PSQPIGYGFQPQFMPGMRPGSGPGNFIVP--YPLQRQPQTGPRMGFRRGATNVQQHIQQ 515 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 35.1 bits (77), Expect = 0.044 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +1 Query: 325 QHGFQPGFQPGYQP--GFAP-GYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQ 477 QH GY P G+ P GYP P+GYP P Q G P G+ QG Q Sbjct: 489 QHPVSAPPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAG-YPPAGYPPPQQGYGQ 541 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 116 KGYETELTMSHKPTPYS-PNFPASHGYVPPPEGEKPNESYP 235 K + +T K Y P P S PPP+G P E YP Sbjct: 470 KPSDKSITEKKKKMSYQDPQHPVS---APPPQGYPPKEGYP 507 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 35.1 bits (77), Expect = 0.044 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFA-PGYPQPSGYPVPVMQQPGPQA--PGGWMNMPQGLQQ 477 P M +G+Q F PG +PG P + P +P+ QPGP+ G NM Q QQ Sbjct: 463 PSQPMGYGYQVQFMPGMRPGAGPPNFMMP--FPLQRQTQPGPRVGFRRGANNMQQQFQQ 519 >At4g19200.1 68417.m02833 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 179 Score = 34.7 bits (76), Expect = 0.058 Identities = 24/56 (42%), Positives = 26/56 (46%), Gaps = 9/56 (16%) Frame = +1 Query: 328 HGFQPG-FQPGYQPGFAP-GYPQPSGYP-----VPVMQQPG--PQAPGGWMNMPQG 468 HGF G P Q G+ P GYP GYP P PG P APGG+ P G Sbjct: 17 HGFPGGGHYPPAQGGYPPQGYPPQQGYPPAGGYPPAGYPPGAYPAAPGGYPPAPGG 72 Score = 31.1 bits (67), Expect = 0.71 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +1 Query: 331 GFQPGFQPGYQPGFAP---GYPQPSGYPVPVMQQPGPQAPG 444 G+ PG P G+ P GYP P+GYP P G G Sbjct: 53 GYPPGAYPAAPGGYPPAPGGYP-PAGYPAPGAHHSGHSGGG 92 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 34.3 bits (75), Expect = 0.076 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 340 PGFQPGYQPGFAPGYPQPSGYPVPVMQQ---PGPQAPGGW 450 PG+Q Y P P P P GYP P P PQ GG+ Sbjct: 14 PGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGY 53 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 143 SHKPTPYSPNFPASHGYVPPP---EGEKPNESYPMHP 244 SH P P P+ P GY PP EG P + Y +P Sbjct: 18 SHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYP 54 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 33.5 bits (73), Expect = 0.13 Identities = 21/60 (35%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +1 Query: 328 HGFQPGFQPGYQPGFAP--GYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRFGIP 501 HG+ P P PG P GYPQ P P P PG + P G P G P Sbjct: 14 HGYPPAGYP--PPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYP 71 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 33.1 bits (72), Expect = 0.18 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 331 GFQPGFQPGYQPGFAPGYPQPSGYP-VPVMQQPGPQAPGGWMNMP 462 G P +QP QPG P P +GYP + + PG P G + P Sbjct: 102 GSMPQYQP--QPGMRPFQPMANGYPGIHGVAPPGAMPPHGLLRYP 144 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 32.7 bits (71), Expect = 0.23 Identities = 24/55 (43%), Positives = 30/55 (54%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQ 474 P PG +G+Q PG +PG G P PS + +P M QP Q PGG P G+Q Sbjct: 263 PQPG--YGYQQQLVPGMRPG---GGPVPSFF-MP-MVQPQQQRPGGG-RRPGGIQ 309 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 128 TELTMSHKPTPYSPNF-PASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHTPA 292 T T SH PTP++P+ P H PP P S+P P HP H P+ Sbjct: 81 TPSTPSHTPTPHTPSHTPTPH--TPPCNCGSP-PSHPSTPSHPSTPSHPTPSHPPS 133 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +2 Query: 158 PYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHTPAYILGHNP 313 PY P+ P++ + P P P S P H + H HTP G P Sbjct: 62 PYDPS-PSTPSH-PSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPP 111 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 32.3 bits (70), Expect = 0.31 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 128 TELTMSHKPTPYSPNF-PASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHTPA 292 T T SH PTP++P+ P H PP P S+P P HP H P+ Sbjct: 81 TPSTPSHTPTPHTPSHTPTPH--TPPCNCGSP-PSHPSTPSHPSTPSHPTPSHPPS 133 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +2 Query: 158 PYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHTPAYILGHNP 313 PY P+ P++ + P P P S P H + H HTP G P Sbjct: 62 PYDPS-PSTPSH-PSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCNCGSPP 111 >At1g54830.3 68414.m06253 CCAAT-box binding transcription factor Hap5a, putative similar to heme activated protein GI:6289057 from (Arabidopsis thaliana) GI:14577940 CCAAT-binding protein subunit HAP5 {Hypocrea jecorina} similar to Transcription factor GB:CAA74053 GI:2398533 from [Arabidopsis thaliana] similarity to transcription factor Hap5a similar to transcription factor Hap5a [Arabidopsis thaliana](GI:6523090) Length = 217 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = +1 Query: 331 GFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSR 489 G + GY G+ P P G P VM PG P +M P Q P + Sbjct: 160 GAEAATAAGYPYGYLPPGTAPIGNPGMVMGNPGAYPPNPYMGQPMWQQPGPEQ 212 >At1g54830.2 68414.m06252 CCAAT-box binding transcription factor Hap5a, putative similar to heme activated protein GI:6289057 from (Arabidopsis thaliana) GI:14577940 CCAAT-binding protein subunit HAP5 {Hypocrea jecorina} similar to Transcription factor GB:CAA74053 GI:2398533 from [Arabidopsis thaliana] similarity to transcription factor Hap5a similar to transcription factor Hap5a [Arabidopsis thaliana](GI:6523090) Length = 217 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = +1 Query: 331 GFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSR 489 G + GY G+ P P G P VM PG P +M P Q P + Sbjct: 160 GAEAATAAGYPYGYLPPGTAPIGNPGMVMGNPGAYPPNPYMGQPMWQQPGPEQ 212 >At1g54830.1 68414.m06251 CCAAT-box binding transcription factor Hap5a, putative similar to heme activated protein GI:6289057 from (Arabidopsis thaliana) GI:14577940 CCAAT-binding protein subunit HAP5 {Hypocrea jecorina} similar to Transcription factor GB:CAA74053 GI:2398533 from [Arabidopsis thaliana] similarity to transcription factor Hap5a similar to transcription factor Hap5a [Arabidopsis thaliana](GI:6523090) Length = 217 Score = 31.9 bits (69), Expect = 0.41 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = +1 Query: 331 GFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSR 489 G + GY G+ P P G P VM PG P +M P Q P + Sbjct: 160 GAEAATAAGYPYGYLPPGTAPIGNPGMVMGNPGAYPPNPYMGQPMWQQPGPEQ 212 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.5 bits (68), Expect = 0.54 Identities = 20/60 (33%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAPG-YPQPSGYP--VPVMQQPGPQAPGGWMNMPQGLQQLPS 486 P + G P F PG P FAPG P P Y P P A + P ++ PS Sbjct: 67 PNLAFGPAPSFAPGPGPSFAPGPAPNPRSYDWLAPASSPNEPPAETPDESSPSPSEETPS 126 >At1g08970.4 68414.m01000 CCAAT-box binding transcription factor Hap5a, putative Length = 231 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 355 GYQPGFAPGYPQPSGYPVPVMQQP-GPQAPGGWMNMPQGLQQLPSR 489 GY G+ P P G P VM P G P +M P QQ P + Sbjct: 181 GYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQ 226 >At1g08970.3 68414.m00999 CCAAT-box binding transcription factor Hap5a, putative Length = 231 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 355 GYQPGFAPGYPQPSGYPVPVMQQP-GPQAPGGWMNMPQGLQQLPSR 489 GY G+ P P G P VM P G P +M P QQ P + Sbjct: 181 GYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQ 226 >At1g08970.2 68414.m00998 CCAAT-box binding transcription factor Hap5a, putative Length = 231 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 355 GYQPGFAPGYPQPSGYPVPVMQQP-GPQAPGGWMNMPQGLQQLPSR 489 GY G+ P P G P VM P G P +M P QQ P + Sbjct: 181 GYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQ 226 >At1g08970.1 68414.m00997 CCAAT-box binding transcription factor Hap5a, putative Length = 231 Score = 31.5 bits (68), Expect = 0.54 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +1 Query: 355 GYQPGFAPGYPQPSGYPVPVMQQP-GPQAPGGWMNMPQGLQQLPSR 489 GY G+ P P G P VM P G P +M P QQ P + Sbjct: 181 GYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQ 226 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 31.1 bits (67), Expect = 0.71 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 152 PTPYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLLCHTPAY 295 P PY P H PPP G +++ P GF P H Y Sbjct: 254 PPPYYSTSPPQHQSYPPPPGHSFHQTQPSQSFHGFAPSSPQNQHGYGY 301 >At1g09070.1 68414.m01012 C2 domain-containing protein / src2-like protein, putative similar to cold-regulated gene SRC2 [Glycine max] GI:2055230; contains Pfam profile PF00168: C2 domain; identical to cDNA src2-like protein GI:3426059 Length = 324 Score = 31.1 bits (67), Expect = 0.71 Identities = 25/68 (36%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Frame = +1 Query: 304 AQPLPGMQHGFQP---GFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGW-MNMPQGL 471 A P G G+ P G PGY P GYPQ GYP PQ P G+ G Sbjct: 220 AYPQQGGYPGYPPQQQGGYPGYPPQGPYGYPQ-QGYP--------PQGPYGYPQQQAHGK 270 Query: 472 QQLPSRFG 495 Q P + G Sbjct: 271 PQKPKKHG 278 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +1 Query: 370 FAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRFGIP 501 + PG+ PS YP P P G + G+ P + G P Sbjct: 166 YPPGHGAPSAYPAPPAGPSSGYPPQGHDDKHDGVYGYPQQAGYP 209 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 30.7 bits (66), Expect = 0.94 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 146 HKPTPYSPNFPASHGYVPPPEGEKPNESY 232 +KP PY + P + Y PPP P+ SY Sbjct: 399 YKPPPYVYSSPPPYVYNPPPSSPPPSPSY 427 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 30.7 bits (66), Expect = 0.94 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +2 Query: 146 HKPTPYSPNFPASHGYVPPPE-GEKPNESYPMHPQSGFLAHHPLLCH 283 H P PY P Y PPPE + P E P S + P+ H Sbjct: 400 HNPPPYMQPPPRHDSYYPPPEMRQPPMEKQPHQGISAYGREPPMNVH 446 >At5g67600.1 68418.m08524 expressed protein Length = 82 Score = 30.3 bits (65), Expect = 1.2 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +1 Query: 331 GFQP-GFQP-GYQP-GFAPGYPQPSGYPVPVMQQPGPQAPGGWM 453 G+ P G+ P GY P G+A GYP GYP P Q Q M Sbjct: 22 GYPPAGYPPAGYPPPGYAQGYP-AQGYPPPQYSQAPQQKQNAGM 64 >At2g13550.1 68415.m01494 expressed protein Length = 181 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 Query: 125 ETELTMSHKPTPYSPNFPASHGYVPPPEGEKPNESYPMHPQ 247 +T L H PT + PN PP P+ES P Q Sbjct: 7 QTPLARMHLPTQFQPNTRTGRQPKSPPNSHHPDESSPSPQQ 47 >At1g62970.1 68414.m07110 DNAJ heat shock N-terminal domain-containing protein low similarity to AHM1 [Triticum aestivum] GI:6691467; contains Pfam profile PF00226: DnaJ domain Length = 797 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 128 TELTMSHKPTPYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHPLL 277 TELT + KPTP S P H + P + +P Y + +S A LL Sbjct: 300 TELTWASKPTPVSE--PVRHSELVPWQYSEPARQYQLSSRSSEAAQLSLL 347 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 29.5 bits (63), Expect = 2.2 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +1 Query: 310 PLPGMQHGF-QPG-FQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLP 483 PL G F QPG F PG P P PSG P P PG M P G+ P Sbjct: 133 PLVGGGSSFPQPGGFPASGPPGGVPSGP-PSGARPIGFGSPPPMGPGMSMPPPSGMPGGP 191 Query: 484 SRFGIP 501 G P Sbjct: 192 LSNGPP 197 >At5g44780.1 68418.m05488 expressed protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 723 Score = 29.1 bits (62), Expect = 2.9 Identities = 24/57 (42%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQ-PGPQAPGGWMNMPQGLQQ 477 PLPG Q G QP YQ GF+ G G PVP Q PG ++N QG Q Sbjct: 464 PLPGQG---QEG-QPSYQMGFSQGL----GAPVPPNQVIPGNYGQWAFVNYNQGPPQ 512 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 334 FQPGFQPGYQPGFAPGY-PQPSGYPVPVMQQPGPQAPG 444 F P PGY P +PGY P GY P P +PG Sbjct: 1537 FSPSSSPGYSPS-SPGYSPTSPGYS-PTSPGYSPTSPG 1572 >At4g20020.2 68417.m02930 expressed protein Length = 406 Score = 29.1 bits (62), Expect = 2.9 Identities = 23/62 (37%), Positives = 25/62 (40%), Gaps = 9/62 (14%) Frame = +1 Query: 316 PGMQHGFQ--PGFQPGYQPG-------FAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQG 468 PG G Q P FQ GY G + GY Q G PVP Q Q G + QG Sbjct: 245 PGQGQGTQAPPPFQGGYNQGPRSPPPPYQAGYNQGQGSPVPPYQAGYNQVQGSPVPPYQG 304 Query: 469 LQ 474 Q Sbjct: 305 TQ 306 >At4g20020.1 68417.m02931 expressed protein Length = 419 Score = 29.1 bits (62), Expect = 2.9 Identities = 23/62 (37%), Positives = 25/62 (40%), Gaps = 9/62 (14%) Frame = +1 Query: 316 PGMQHGFQ--PGFQPGYQPG-------FAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQG 468 PG G Q P FQ GY G + GY Q G PVP Q Q G + QG Sbjct: 245 PGQGQGTQAPPPFQGGYNQGPRSPPPPYQAGYNQGQGSPVPPYQAGYNQVQGSPVPPYQG 304 Query: 469 LQ 474 Q Sbjct: 305 TQ 306 >At3g14010.1 68416.m01769 hydroxyproline-rich glycoprotein family protein similar to Mrs16p (GI:2737884) [Saccharomyces cerevisiae]; weak similarity to ataxin-2 related protein (GI:1679686) [Homo sapiens] Length = 595 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 4/62 (6%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQ--PGPQAPGG--WMNMPQGLQQ 477 P PG Q Q Y P P YPQ P QQ PG Q P +M+ P Q Sbjct: 527 PYPGNQPQMMYHPQAYYHPNGQPQYPQQQMIPGQQQQQMIPGQQHPRPVYYMHPPPYPQD 586 Query: 478 LP 483 +P Sbjct: 587 MP 588 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/62 (29%), Positives = 23/62 (37%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPGGWMNMPQGLQQLPSRFG 495 P +G +P + PG P G +P P P GP P G P +P G Sbjct: 173 PPPPYGMRPPY-PGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGG 231 Query: 496 IP 501 P Sbjct: 232 AP 233 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPG-PQAP 441 P GM G P P PG P P G P+ PG P AP Sbjct: 202 PPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHPGMPPAP 246 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.7 bits (61), Expect = 3.8 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPG 444 QP P +QH GY P P YPQ S P P Q P PG Sbjct: 340 QPPPQLQH------PSGYNPE-EPPYPQQSYPPNPPRQPPSHPPPG 378 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 152 PTPYSPNFPASHGYVPPPEGEKPNESYPMHP 244 P PY P P+S Y PPP + YP P Sbjct: 22 PAPYRP--PSSEPYPPPPTNQYSAPYYPYPP 50 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 304 AQPLPGMQHGF-QPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 + P PG PG P P P P PS P + PGP P Sbjct: 236 SSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 >At4g23470.2 68417.m03383 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 199 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAP-GYPQPSGYPVPVMQQPGPQA 438 P + + Q G+ P P P GYP PSGYP Q P P A Sbjct: 146 PAVGYPPQQGYPPSGYPQHPPQGYP-PSGYP----QNPPPSA 182 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = +2 Query: 131 ELTMSHKPTPYSPNFPASHGYVP------PPEGEKPNESYPMHPQSGFLAHHPLLCHTP 289 +++ + TP + +P GY P PP+G P+ YP +P + +P + P Sbjct: 136 QMSRFDQATPPAVGYPPQQGYPPSGYPQHPPQGYPPS-GYPQNPPPSAYSQYPPGAYPP 193 >At4g23470.1 68417.m03382 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 255 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = +1 Query: 316 PGMQHGFQPGFQPGYQPGFAP-GYPQPSGYPVPVMQQPGPQA 438 P + + Q G+ P P P GYP PSGYP Q P P A Sbjct: 202 PAVGYPPQQGYPPSGYPQHPPQGYP-PSGYP----QNPPPSA 238 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 6/59 (10%) Frame = +2 Query: 131 ELTMSHKPTPYSPNFPASHGYVP------PPEGEKPNESYPMHPQSGFLAHHPLLCHTP 289 +++ + TP + +P GY P PP+G P+ YP +P + +P + P Sbjct: 192 QMSRFDQATPPAVGYPPQQGYPPSGYPQHPPQGYPPS-GYPQNPPPSAYSQYPPGAYPP 249 >At3g07660.1 68416.m00918 expressed protein Length = 841 Score = 28.3 bits (60), Expect = 5.0 Identities = 22/61 (36%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = +2 Query: 134 LTMSHKPTPYSPNFPASHGYVPPPEGEK--PNESYPMHPQ-SGFLAHHPLLCHTPAYILG 304 L MSH P Y P S Y+PPP + N +Y PQ SG P Y L Sbjct: 623 LHMSHYPPNYVPYGYFSPFYLPPPTMHQYLSNGAYAQQPQASGVYPPPPGTATGGKYTLP 682 Query: 305 H 307 H Sbjct: 683 H 683 >At2g34720.1 68415.m04264 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 198 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 Query: 322 MQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAPG 444 M HG P P Y+ FA P YP +Q G Q PG Sbjct: 48 MAHGLYPYPDPYYRSVFAQQAYLPHPYPGVQLQLMGMQQPG 88 >At2g16470.1 68415.m01887 zinc finger (CCCH-type) family protein / GYF domain-containing protein contains Pfam domains PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar), PF02213: GYF domain Length = 659 Score = 28.3 bits (60), Expect = 5.0 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +1 Query: 376 PGYPQPSGYPVPVMQQPGPQAPGGW-MNM 459 PG+P + V V QP QA W MNM Sbjct: 441 PGFPPSDSWKVAVPSQPNAQAQAQWGMNM 469 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 28.3 bits (60), Expect = 5.0 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 6/55 (10%) Frame = +1 Query: 337 QPGFQ-PGYQPGFAPGYPQPSG-----YPVPVMQQPGPQAPGGWMNMPQGLQQLP 483 +PG+ P Y P P Y P G YP QQP P G PQG Q P Sbjct: 774 RPGYSIPPYGP--PPPYHTPHGQAPQPYPPQAQQQPHPSWQQGSYYDPQGQQPRP 826 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +1 Query: 319 GMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVM-QQPGPQAPG 444 GM G+ G Q PG PGY +GY QQPG G Sbjct: 396 GMPSGY--GTQANISPGVYPGYGAQAGYQGGYQTQQPGQGGAG 436 >At2g39050.1 68415.m04800 hydroxyproline-rich glycoprotein family protein contains QXW lectin repeat domain, Pfam:PF00652 Length = 317 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 113 EKGYETELTMSHKPTPY--SPNFPASHGYVPPPEGEKPNESYP 235 E +E ++ PY +P P S G+V + PNESYP Sbjct: 62 ETQFEPHAPPPYRSEPYFETPAPPPSFGHVSHVGHQSPNESYP 104 >At1g77500.1 68414.m09025 expressed protein contains Pfam domains, PF04782: Protein of unknown function (DUF632) and PF04783: Protein of unknown function (DUF630) Length = 879 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Frame = +1 Query: 352 PGYQPGFAPGYP--QPSGY 402 P Y PG+ PGYP P+GY Sbjct: 159 PVYPPGYPPGYPFSYPTGY 177 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 340 PGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 P P Y P P P Y +PV Q P P +P Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSP 723 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 328 HGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGP 432 HG+ PG Y P YP P GYP P P P Sbjct: 22 HGYPPG---AYPPPPQGAYPPPGGYP-PQGYPPPP 52 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 Query: 307 QPLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPG 429 Q P HG+ P P PG YP P+GYP P +PG Sbjct: 46 QGYPPPPHGYPPAAYPP-PPG---AYP-PAGYPGPSGPRPG 81 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGP 432 P P + H QP QP P P P P P P P Sbjct: 847 PPPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPP 887 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 358 YQPGFAPGYPQPSGYPVPVMQQPGPQ 435 Y P F YP P YP P+ + P P+ Sbjct: 133 YSPPFKK-YPPPEQYPPPIKKYPPPE 157 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +1 Query: 310 PLPGMQHGFQPGFQPGYQPGFAPGYPQPSGYPVPVMQQPGPQAP 441 P H P F P +QP P P P +P P P P P Sbjct: 37 PFSPPHHPPPPHFSPPHQP---PPSPYPHPHPPPPSPYPHPHQP 77 >At5g01160.1 68418.m00020 e-cadherin binding protein-related contains weak similarity to E-cadherin binding protein E7 [Mus musculus GP|9622093|gb|AAF89617 Length = 360 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 8/57 (14%) Frame = +1 Query: 316 PGMQHGFQPGFQPGY-QPGFA-PGYPQPSGY------PVPVMQQPGPQAPGGWMNMP 462 P + PGF+ +PG P YPQP PVP+ Q PG G+ + P Sbjct: 215 PDSDNSRPPGFETASPKPGIRFPDYPQPMNLMQPPSLPVPMNQNPGLPQQFGFPSYP 271 >At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) family protein similar to C-terminal zinc-finger [Glycine max] GI:558543; contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 486 Score = 27.5 bits (58), Expect = 8.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 5/52 (9%) Frame = +2 Query: 110 YEKGYETELTMSHKPTPYSPNFPASHGYVPPPE---GEKPNESY--PMHPQS 250 + + +ET + + P+ Y N SH VPPP P+ SY +HP S Sbjct: 254 FPRYHETSSSRNPTPSVYQRNHYISHHPVPPPPIVYPHMPSASYAETLHPAS 305 >At2g27260.1 68415.m03276 expressed protein Length = 243 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 373 APGYPQPSGYPVPVMQQP 426 A GYP P YP P QQP Sbjct: 8 ATGYPYPYPYPNPQQQQP 25 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 27.5 bits (58), Expect = 8.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +2 Query: 119 GYETELTMSHKPTPYSPNFPASHGYVPPPEGEKPNESYPMHP 244 G ++ T S P+P P P H PP E +PN+ Y P Sbjct: 387 GGSSQATPSKSPSPV-PTRPV-HKPQPPKESPQPNDPYNQSP 426 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 143 SHKPTPYSPNFPASHGYVPPPEGEKPNESYPMHPQSGFLAHHP 271 S P+P P P PPP ++P S P P HP Sbjct: 214 SEHPSPPPPGHPKRREQPPPPGSKRPTPS-PPSPSDSKRPVHP 255 >At1g19310.1 68414.m02401 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 226 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 203 PEGEKPNESYPMHPQSGFLAHH 268 P G++P + P P GF HH Sbjct: 99 PSGQRPETAQPPDPNHGFAHHH 120 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +2 Query: 146 HKPTPYSPNFPASHGYVPPP--EGEKPNESYPMHPQSG 253 + P+PY +P +H + P P P +YP Q G Sbjct: 399 YMPSPYQQQYPPNHHHQPSPMQHYAPPPAAYPYPQQPG 436 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,051,334 Number of Sequences: 28952 Number of extensions: 304102 Number of successful extensions: 1434 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -