BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060450.seq (679 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7560| Best HMM Match : Metallothio_PEC (HMM E-Value=1.3) 26 0.89 >SB_7560| Best HMM Match : Metallothio_PEC (HMM E-Value=1.3) Length = 350 Score = 26.2 bits (55), Expect(2) = 0.89 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 586 SALA*KRKTSSS*CPNGTWCR 524 SA+ + +TS+ CP G WCR Sbjct: 240 SAMVREDETSAGGCPPGFWCR 260 Score = 23.4 bits (48), Expect(2) = 0.89 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = -1 Query: 547 CPNGTWCRGCRYWDKL*IK-----WCDGXXNIXSDNSSQ 446 CP G WC+ Y D WC NI D +SQ Sbjct: 297 CPPGFWCKRGVYNDNDDGNCPPGFWCKKKRNIKEDPTSQ 335 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,180,441 Number of Sequences: 59808 Number of extensions: 268906 Number of successful extensions: 518 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 518 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1745338465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -