BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060450.seq (679 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g05150.1 68417.m00773 octicosapeptide/Phox/Bem1p (PB1) domain... 31 0.93 At1g01580.1 68414.m00075 ferric-chelate reductase, putative simi... 29 3.7 >At4g05150.1 68417.m00773 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein various predicted proteins contains Pfam profile PF00564: PB1 domain Length = 477 Score = 30.7 bits (66), Expect = 0.93 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 480 PSHHLIQSLS---QYLQPLHHVPFGH*DELVFRFQARAE*VFSDRKRPCLRSV 629 P +H++Q + QYLQ HHVP G+ + + V+ RP + +V Sbjct: 377 PGNHMVQPVQMPGQYLQQYHHVPMGYHQPQTHQMAGPGQ-VYGGTVRPVMMAV 428 >At1g01580.1 68414.m00075 ferric-chelate reductase, putative similar to ferric-chelate reductase (FRO1) [Pisum sativum] GI:15341529; contains Pfam profile: PF01794 ferric reductase like transmembrane component Length = 725 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 34 FVILIKSNTMLLW*RAI*NVCMLWLLLRPFHYRIKWKPK*RLIF 165 F +IK T L MLW+++ YR KW P R+ F Sbjct: 19 FKDMIKGVTKFLMMVIFLGTIMLWIMMPTLTYRTKWLPHLRIKF 62 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,224,298 Number of Sequences: 28952 Number of extensions: 181101 Number of successful extensions: 304 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 304 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1428369392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -