BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060447.seq (686 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 26 1.3 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 25 3.0 AY117999-1|AAM66798.1| 120|Anopheles gambiae glucose-6-phosphat... 24 3.9 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 5.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.8 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 6.8 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 6.8 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 6.8 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 6.8 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 9.0 AY118017-1|AAM66816.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY118012-1|AAM66811.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY118011-1|AAM66810.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY118010-1|AAM66809.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY118002-1|AAM66801.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY118001-1|AAM66800.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY118000-1|AAM66799.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY117998-1|AAM66797.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY117995-1|AAM66794.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AY117994-1|AAM66793.1| 120|Anopheles gambiae glucose-6-phosphat... 23 9.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.0 AF317817-1|AAL18436.1| 137|Anopheles gambiae glucose-6-phosphat... 23 9.0 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 9.0 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 677 ASHSWRTPSWPHHDPCPGGAPIIPGR 600 AS + +PS+PH +P P A +I R Sbjct: 429 ASGTGMSPSYPHSEPSPDYAMLIGSR 454 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 590 GWPSFQE*WELL 625 GWP+F E WE+L Sbjct: 258 GWPAFGELWEVL 269 >AY117999-1|AAM66798.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 24.2 bits (50), Expect = 3.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 234 LILGDCENSEKLNLKIVKLQTEKKKELWVLFFYV 335 L + + E + +K+ + Q EK +E W + FYV Sbjct: 10 LSVAELEEKCRQYMKVQEDQVEKFEEFWSVNFYV 43 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 5.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 307 FFFSVCSFTIFRFNFSEFSQSPN 239 F F +C F+ R+ F +F PN Sbjct: 414 FCFLICLFSFPRYYFIDFRVKPN 436 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 6.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 494 QDLEDPEVLRPGQCLYQQHEHFQA 423 +D ED + L Q QQH+H QA Sbjct: 629 EDEEDQQHLLQQQQQQQQHQHHQA 652 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 515 LNNTWAPGNRGQLS-APPSNARRPHDGWP 598 +NN APGN G L+ + S+A H P Sbjct: 447 MNNILAPGNMGSLNESGDSDAHLSHPDHP 475 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 515 LNNTWAPGNRGQLS-APPSNARRPHDGWP 598 +NN APGN G L+ + S+A H P Sbjct: 447 MNNILAPGNMGSLNESGDSDAHLSHPDHP 475 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 515 LNNTWAPGNRGQLS-APPSNARRPHDGWP 598 +NN APGN G L+ + S+A H P Sbjct: 431 MNNILAPGNMGSLNESGDSDAHLSHPDHP 459 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 6.8 Identities = 12/29 (41%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 515 LNNTWAPGNRGQLS-APPSNARRPHDGWP 598 +NN APGN G L+ + S+A H P Sbjct: 407 MNNILAPGNMGSLNESGDSDAHLSHPDHP 435 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 632 MGRGGARTGSSRNATLLV 685 +G GGAR G S ++LLV Sbjct: 980 LGSGGARHGHSLTSSLLV 997 >AY118017-1|AAM66816.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQAEKFEEFWSVNFYV 43 >AY118012-1|AAM66811.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQVEKFEEFWSVNFYV 43 >AY118011-1|AAM66810.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQAEKFEEFWSVNFYV 43 >AY118010-1|AAM66809.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQVEKFEEFWSVNFYV 43 >AY118002-1|AAM66801.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQVEKFEEFWSVNFYV 43 >AY118001-1|AAM66800.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQAEKFEEFWSVNFYV 43 >AY118000-1|AAM66799.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQVEKFEEFWSVNFYV 43 >AY117998-1|AAM66797.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQVEKFEEFWSVNFYV 43 >AY117995-1|AAM66794.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 MKVQEDQAEKFEEFWSVNFYV 43 >AY117994-1|AAM66793.1| 120|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 120 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 23 IKVQEDQAEKFEEFWSVNFYV 43 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 644 HHDPCPGGAPIIPGRRATHHGASSH 570 +HDP P RA+HH A+ H Sbjct: 389 YHDPAIYLDPRYQMLRASHHSAAGH 413 >AF317817-1|AAL18436.1| 137|Anopheles gambiae glucose-6-phosphate dehydrogenase protein. Length = 137 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 273 LKIVKLQTEKKKELWVLFFYV 335 +K+ + Q EK +E W + FYV Sbjct: 31 MKVQEDQVEKFEEFWSVNFYV 51 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +2 Query: 500 GVGGHLNNTWAPGNRGQLSAPPSNARRPHDGWPSF 604 G+ G N PG +GQ P + G P F Sbjct: 603 GLMGRPGNDGLPGPQGQRGLPGPQGEKGDQGPPGF 637 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,010 Number of Sequences: 2352 Number of extensions: 10705 Number of successful extensions: 41 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -