BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060439.seq (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 26 0.40 AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 21 8.6 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 25.8 bits (54), Expect = 0.40 Identities = 19/78 (24%), Positives = 36/78 (46%) Frame = -1 Query: 427 SLSMGTIXSTPIFLKPACNILKFCIYSCSKFVLNLILFXGTLPGNSMSMNWQ*AAPVQXL 248 SL +G + T F +I I S + + ++L LP N +S+ + + + Sbjct: 418 SLGIGEVI-TVSFTATLASIGAASIPSAALITMLIVLTALGLPTNDISLLFAVDWMLDRI 476 Query: 247 RSSQSLTGDNHSPTLAYH 194 R+S ++ GD + + YH Sbjct: 477 RTSINVLGDGYGAGIVYH 494 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 21.4 bits (43), Expect = 8.6 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +1 Query: 178 ENLSRHDMLAWVNDC 222 +NL+++ M+ W DC Sbjct: 13 KNLNQNQMMIWALDC 27 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,332 Number of Sequences: 438 Number of extensions: 3443 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -