BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060435.seq (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 4.0 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 6.9 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 6.9 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 112 SQSPSTP*TRXYGSIRSNNLC 50 S STP R YG++ N C Sbjct: 414 SDQRSTPSPRVYGNVNENQDC 434 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 49 CKGYWI*WIRXDVSRASTVTGSCMI 123 CKG++ +R D+S A +C+I Sbjct: 106 CKGFFKRTVRKDLSYACREEKNCII 130 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/39 (20%), Positives = 21/39 (53%) Frame = +3 Query: 375 ASLNRLINL*LFLSLVSREMQATECMGSTLTASYLQFTL 491 A + + + L + + + + E + + C+G T+T + F + Sbjct: 304 AKVTKTVLLGVKIDICNEEERNSHCLGGTITRTMWYFQI 342 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,463 Number of Sequences: 336 Number of extensions: 1991 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -