BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060435.seq (668 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 26 5.6 SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyc... 25 7.5 SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 25 7.5 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 25 9.9 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 25.8 bits (54), Expect = 5.6 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 149 PPLTTPRILIMQEPVTVDALDTSLRIHQIQ*PLH*MP 39 PP+ +PR +PV V+A+ S + Q PLH P Sbjct: 270 PPIPSPR---PPQPVAVEAIQQSRAVISQQLPLHVSP 303 >SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyces pombe|chr 3|||Manual Length = 1088 Score = 25.4 bits (53), Expect = 7.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 126 PDHAGASHRRRPRHVXTDPSDPITFALDAFSS 31 P HA +SH+ V +DP+ P D S Sbjct: 430 PKHASSSHKSSIMSVNSDPTSPKVSKFDTSDS 461 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 25.4 bits (53), Expect = 7.5 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 487 LLSYMFISGLFINNRFRXKNYSSDFXSLR 573 L +++ SGLF N F SS+F SLR Sbjct: 459 LANHLSSSGLFDNGLFSSGGLSSNFSSLR 487 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.0 bits (52), Expect = 9.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 47 NAKVIGSDGSVXTCLGRRR 103 N++ +GS GS T LGRRR Sbjct: 3 NSRSVGSTGSNNTPLGRRR 21 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,070,717 Number of Sequences: 5004 Number of extensions: 32939 Number of successful extensions: 58 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 305854096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -