BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060431.seq (673 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 120 1e-27 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 37 0.013 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 37 0.017 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 33 0.16 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.64 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 3.4 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 3.4 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.4 SB_35101| Best HMM Match : AT_hook (HMM E-Value=4.7) 29 3.4 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_21326| Best HMM Match : Myosin_head (HMM E-Value=5e-05) 29 4.5 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 6.0 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_10758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 6.0 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 7.9 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 7.9 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 120 bits (288), Expect = 1e-27 Identities = 60/105 (57%), Positives = 68/105 (64%) Frame = +1 Query: 97 VGVFREE*DGAGCSQAPPVRVQGAHPSGPGQ*CSRFYVQELEAALLREQGGWSQTSAESW 276 + VF E + AG + P V P S + + + + G QTSAESW Sbjct: 6 ITVFNENGESAGQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAG-HQTSAESW 64 Query: 277 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 411 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 65 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWH 109 Score = 36.7 bits (81), Expect = 0.017 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +3 Query: 453 SVAATGVPALVQARGHIIERFPSFPWL*PTKSKRSTRPNRLSSS*GRLKAWSDILXVYKS 632 ++AA+ +PAL+ ARGH IE+ P + + T+ + + A+ D+ S Sbjct: 124 ALAASALPALIMARGHRIEKIAEVPLVISDAIESVTKTSAAVKLLKAVNAYEDVEKCIDS 183 Query: 633 QRLRAG 650 +++RAG Sbjct: 184 KKIRAG 189 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 37.1 bits (82), Expect = 0.013 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +1 Query: 244 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 405 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 14 GGWGQGPGGGWGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +1 Query: 244 GGWSQTSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 399 GG + WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 36.7 bits (81), Expect = 0.017 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +1 Query: 244 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 405 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 258 GGWGQGPGGGWGRGQGRG-MGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 370 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWF 257 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 31.9 bits (69), Expect = 0.48 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 355 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 263 Y +HP T+ YH H R H Q+P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 Score = 31.5 bits (68), Expect = 0.64 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 355 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 263 Y +HP T+ YHH H + ++ Q+P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.64 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 287 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 379 TYVHHDTCYRRHPDRTYEYHHHGHA 305 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 3.4 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -1 Query: 382 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 278 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 3.4 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +1 Query: 211 QELEAALLREQGGWSQTSAESWGTGRA----VARIPR-VRGGGTHRS 336 + E+AL E+ W+Q AES T RA +AR+ R GT RS Sbjct: 3432 EHAESALAAERAQWAQEKAESQNTIRAANEEIARLKEDARKAGTERS 3478 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 259 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 375 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_35101| Best HMM Match : AT_hook (HMM E-Value=4.7) Length = 221 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 517 RASLGCSRQSPRDQQDQTGCHLPEGASRHG 606 RA G SR SP D T LP G++R+G Sbjct: 167 RAGSGKSRDSPNDLIADTADQLPSGSTRNG 196 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 529 GCSRQSPRDQQDQTGCHLPEGASRH 603 G ++QSP D+Q Q G + PEG+ H Sbjct: 1354 GETKQSPPDKQCQPGHYCPEGSGLH 1378 >SB_25030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 334 TYEYHHHGHAEFGRQHVQYPMI-QHWFGTSLLAHAVGLP-RVLGHRNVN 194 +Y++HHHG E Q V I + W L +H P RV+G ++ Sbjct: 21 SYQWHHHGTGETDDQPVTTTRITRTWVNRRLNSHRTIKPSRVIGRAQIH 69 >SB_21326| Best HMM Match : Myosin_head (HMM E-Value=5e-05) Length = 469 Score = 28.7 bits (61), Expect = 4.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = -1 Query: 613 ISDHALRRPQEDDSLFGLVDLLDFVGYNQGKLGNLSIMC 497 +SD L+ P + + GLV ++D G+ ++ L+ +C Sbjct: 88 LSDGLLKTPPQGTGVSGLVSVMDMFGFENCEVNGLNQIC 126 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYEYHHH 314 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 150 GRGLAAPCTVSLFSEYTDTKGRATDRLI 67 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_10758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 28.3 bits (60), Expect = 6.0 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 7/89 (7%) Frame = +2 Query: 5 TRSLSPLLVYISEV*LR*SSEMSLSVARPLV---SVYSEKSETVQGAAKPLPFVFKAPIR 175 TR PLLV++ + + ++ S PL S + +E + LP V AP+ Sbjct: 451 TRDFCPLLVHMETQKHKEARLLACSPQMPLDFPRSFLEDYAEACANLKQSLPQVHLAPLA 510 Query: 176 PDLVNDVHVSMSKNSRQPY----CVSKEA 250 D+V +V S K S + Y C S EA Sbjct: 511 SDIVREVESSEVKLSLKFYVSENCPSVEA 539 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 6.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 376 YVHHDTCYRRHPDRTYEYHHHGH 308 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYEYHHH 314 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 7.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 370 HHDTCYRRHPDRTYEYHHHGH 308 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 358 CYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 263 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,590,153 Number of Sequences: 59808 Number of extensions: 434512 Number of successful extensions: 1355 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1295 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1721264831 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -