BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060430.seq (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 33 0.003 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 5.6 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 32.7 bits (71), Expect = 0.003 Identities = 25/78 (32%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = -1 Query: 557 NDCVSGKRPLELFESEQSDCGNGC-GYDCASNYDGGNET*TCACDRNDSCMAMRGDHIAP 381 N C +G +L S C +G GY C N D AC N +C+ G Sbjct: 229 NPCQNGGTCHDLVNSFSCSCPSGTLGYICEINVDDCRPG---ACHNNGTCLDKVGGF--- 282 Query: 380 SEREVPCRPTFVRPSCPG 327 E C P FV P C G Sbjct: 283 ---ECKCPPGFVGPRCEG 297 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 378 RWRDMVAPHRHTGVV 422 RWRD + H+GVV Sbjct: 310 RWRDRIYDAIHSGVV 324 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,143 Number of Sequences: 336 Number of extensions: 2805 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -