BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060430.seq (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 4e-16 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 44 9e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 44 2e-04 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 44 2e-04 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 41 9e-04 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 37 0.018 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 37 0.018 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.032 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.042 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 35 0.056 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 35 0.056 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 34 0.098 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 34 0.098 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.098 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.17 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 33 0.30 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 32 0.39 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 32 0.52 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.52 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.91 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 31 1.2 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 1.2 SB_55826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) 29 2.8 SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 29 2.8 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 29 2.8 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 29 3.7 SB_14150| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) 29 3.7 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 29 3.7 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 29 3.7 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 29 4.9 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 4.9 SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 4.9 SB_6097| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.7) 29 4.9 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 28 6.4 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 28 8.5 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 82.2 bits (194), Expect = 4e-16 Identities = 43/91 (47%), Positives = 51/91 (56%) Frame = +3 Query: 129 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPEIGTQGKVEDSPS*GFSS 308 R PP IDGM SLKVDNLTYRTT EDL++VF++ G++GDIYIP + F Sbjct: 7 RGPPEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYE 66 Query: 309 VVMLKKPWTRWTDECWTAGNFAFRWRDMVAP 401 + C A F FRWRDMV P Sbjct: 67 KRDAEDAMDCMDATCLMAEKFVFRWRDMVVP 97 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/43 (44%), Positives = 30/43 (69%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 DR T+ RGFAFV F +++ E+A++ +DG+ DGR ++V A Sbjct: 263 DRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQA 305 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 DR T RGF FV F + ++A+D DG LDGR ++V A Sbjct: 43 DRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKA 85 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 44.4 bits (100), Expect = 9e-05 Identities = 20/43 (46%), Positives = 27/43 (62%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 DR T RGF FV F + + E+A+D DG+ LDGR ++V A Sbjct: 130 DRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEA 172 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 DR T RGF FV F + + E+A+D DG+ DGR ++V A Sbjct: 38 DRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQA 80 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/41 (46%), Positives = 27/41 (65%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 379 DR SRGFA+V + + + E+AL MDG +DG+E+ VQ Sbjct: 1191 DRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQ 1231 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 R GFAF F +RRDAE+A+ +DGR + G+ +RV++A Sbjct: 65 RNPPGFAFCIFDDRRDAEDAVRELDGRYICGQRVRVELA 103 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 R GFAF F +RRDAE+A+ +DGR + G+ RV++A Sbjct: 35 RNPPGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELA 73 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 41.1 bits (92), Expect = 9e-04 Identities = 17/45 (37%), Positives = 28/45 (62%) Frame = +2 Query: 251 SRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 ++D++T +S+GFAF+ F R DA A++ + G D L V+ A Sbjct: 213 AKDKFTNQSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWA 257 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 41.1 bits (92), Expect = 9e-04 Identities = 17/44 (38%), Positives = 30/44 (68%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 RD+ TRESRG AF+ F +R+ A+ A+ ++ + + GR ++ +A Sbjct: 43 RDKETRESRGVAFILFIDRQSAQNAVAAVNKKQMFGRTIKCTIA 86 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/43 (41%), Positives = 27/43 (62%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 DR + ESRGF FV + + A++ L M G +DGR++R+ A Sbjct: 320 DRESGESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFA 362 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 159 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPEIG 263 SL V NL+Y TT + L FE C I+ E G Sbjct: 290 SLIVRNLSYDTTTDSLGAAFEGCSNAKVIFDRESG 324 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 37.1 bits (82), Expect = 0.014 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 RDR T +S G+AFV + DA +A+ M+G L + L+V A Sbjct: 60 RDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 103 Score = 31.9 bits (69), Expect = 0.52 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 272 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 E RG FVRF +R +A+ A+D ++ + L G +++ Sbjct: 151 EGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKL 185 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 R GFAFV + + RDAEEA+ +DG + R +RV+ + Sbjct: 37 RNPPGFAFVEYEDYRDAEEAVRELDGANVCDRTIRVEFS 75 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 36.7 bits (81), Expect = 0.018 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Frame = +2 Query: 242 YLHSRDRYTRESRG----FAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 379 Y H D + RG FAFV F + RDAE+A+ DG DG +RV+ Sbjct: 284 YGHIADVDLKNRRGAGPPFAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVE 333 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 35.9 bits (79), Expect = 0.032 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 D T S+G+ FV+F E A+ A++ M+G L GR L++ Sbjct: 276 DSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 35.5 bits (78), Expect = 0.042 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 +D +S+GF FV F R DA +A+ MD + G++++ A Sbjct: 546 KDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWA 589 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 35.1 bits (77), Expect = 0.056 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 D T + RGF FV F D A+D M+ L GR +RV +A Sbjct: 39 DYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLA 81 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 35.1 bits (77), Expect = 0.056 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +2 Query: 278 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 RG+ FV F + RDAE+A+ ++GR L G + V+ + Sbjct: 722 RGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFS 757 Score = 28.7 bits (61), Expect = 4.9 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = +3 Query: 123 YGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEV--GDIYIPEIGTQGKVE 281 YG PP R + S+ V+NL+ RT+ +DL+ F + G+V D + IG +G VE Sbjct: 790 YG-PPVRTN--YSVIVENLSSRTSWQDLKDYFRKYGKVTYADAHKKRIG-EGVVE 840 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.1 bits (77), Expect = 0.056 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +2 Query: 275 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 SRGF FV F DA+ A+ +++G+ + GR L++ Sbjct: 98 SRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 34.3 bits (75), Expect = 0.098 Identities = 15/39 (38%), Positives = 25/39 (64%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 R+ R + FV F +R A +A+D ++G +DG +L V +A Sbjct: 32 RKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLA 70 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 34.3 bits (75), Expect = 0.098 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 RD+ T ES +AF+ F + D E A MD ++D R + V + Sbjct: 153 RDQKTGESLQYAFIEFEKDEDCERAYFKMDNVLIDDRRIHVDFS 196 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +2 Query: 272 ESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 370 +S+GF FV F +AEEA++ ++G+ + GR L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 Score = 31.1 bits (67), Expect = 0.91 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 275 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 S+GF FV F +A +A+ M+GR+L + L V +A Sbjct: 251 SKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALA 287 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 RD T S+GFAF+ F ++ A++ M+G+ L R + V A Sbjct: 134 RDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYA 177 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 +DR T+ +G+ FV F DA+ A+ M+ + G+ +RV A Sbjct: 46 KDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKA 89 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 RD+ T + +GF F+ + ++R A+D +G L GR +RV Sbjct: 12 RDKKTGKQKGFCFLCYEDQRSTILAVDNFNGIKLGGRTIRV 52 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDT---MDGRMLDGR 364 D TR SRGF FVRF + DA+ L T + GR+ + R Sbjct: 149 DPNTRRSRGFGFVRFKKDEDAKNVLSTSHRIQGRLCEVR 187 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 129 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPE 257 RP ++ L V L TT + L F + GEV D+YIP+ Sbjct: 190 RPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPK 232 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 DR T + +G+ F + ++ A A+ ++G L+GR LRV A Sbjct: 59 DRETGKPKGYGFCEYKDQETALSAMRNLNGYELNGRALRVDSA 101 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 ++ + +AFV F ER A +A++ DG+ +DG ++ +A Sbjct: 359 KKLKDYAFVHFTERDHALKAIEETDGKEMDGLKIEASLA 397 >SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 278 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 382 RG+AF+ + RD A DG+ +DGR + V + Sbjct: 47 RGYAFIEYEHERDMHAAYKHADGKKIDGRRIVVDV 81 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGR 349 +D+ T+E+RG +V+F + A A + MDGR Sbjct: 56 KDKATKENRGVCYVKFVKASSAALACEEMDGR 87 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 275 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 SRGFAFV + +AE+ +GR ++G +RV Sbjct: 246 SRGFAFVDYATAEEAEKGQRAHNGRQVEGSNIRV 279 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +2 Query: 251 SRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 373 SR + + S+G+AFV F A+ A DTM M+ GR L+ Sbjct: 130 SRSKKSARSKGYAFVEFACDEVAKIAADTMHNYMMFGRLLK 170 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +2 Query: 251 SRDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 S D + +GFAFV + A+ AL+ M+G +L GR ++V Sbjct: 134 SWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKV 175 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 31.1 bits (67), Expect = 0.91 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +3 Query: 162 LKVDNLTYRTTPEDLRRVFERCGEVGDI 245 L V +L + TT ++LR FE+CGE+ I Sbjct: 238 LMVQDLDFDTTVDELREYFEKCGELTGI 265 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +2 Query: 281 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 382 GF FV F +A +A + ++G ++DGR++ V + Sbjct: 125 GFGFVTFNTAAEANKAREKLNGTIVDGRKVEVSL 158 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 275 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 SRGF FV + D E+ DG +GR L+V A Sbjct: 82 SRGFGFVTLENQEDLEDVTRKFDGFEYEGRRLKVAEA 118 >SB_55826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 201 DLRRVFERCGEVGDIYIPEIGTQGKVEDSPS 293 D +R E GE G+ + PE GT+G+ + SPS Sbjct: 646 DSKRKEEERGEGGEEFSPEEGTEGRDDGSPS 676 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMD 343 RD TRE++G+ +V+F + A AL+ D Sbjct: 86 RDHKTRENKGYGYVKFHKSSTAAMALENCD 115 >SB_53070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 347 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 382 D+ T S+ F FV + A+ A+ M+G + + L+VQ+ Sbjct: 296 DKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQL 337 >SB_37198| Best HMM Match : RRM_1 (HMM E-Value=7.8e-23) Length = 362 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 382 D+ T S+ F FV + A+ A+ M+G + + L+VQ+ Sbjct: 311 DKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQL 352 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 382 ++S+G V+F +A A++ + G+ML R LRV+M Sbjct: 222 KKSKGMGTVQFETPMEAMNAVNLLHGKMLMDRALRVRM 259 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 431 CDRNDSCMAMRGDHIAPSEREVP--CRPTFVRPSCP 330 C+ +D C G+ P E E P CR T + SCP Sbjct: 27 CNSDDKCSP--GERCRPQENECPLKCRKTIKKKSCP 60 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 263 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 + + +GF F+R R AE A +D GR LRV+ A Sbjct: 82 FINKEKGFGFIRLDTRLHAEAAKAGLDMATRKGRTLRVRFA 122 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 +DR T++S+G+ FV DA E M++GR+ V +A Sbjct: 43 KDRVTKKSKGYGFVT-MATSDAAELACKNKRPMIEGRQANVNLA 85 >SB_14150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -1 Query: 497 GN-GCGYDCASNYDGGNET*TCACDRNDSC 411 GN GCGY C NY GN CD N C Sbjct: 171 GNYGCGYGCDGNYGCGN-----GCDGNYGC 195 >SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) Length = 292 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +2 Query: 284 FAFVRFFERRDAEEALDTMDGR-MLDGRELRVQMA 385 +AFV+F+ + A A + ++G+ ++DG L+VQ A Sbjct: 80 YAFVKFYSAKAALRAKEEVNGKWLIDGNILKVQFA 114 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 497 GNGCGYDCASNYDGGNET*TCACDRNDSCMAMRG 396 GN C C + G N C C N +C A+ G Sbjct: 652 GNACDRPCPAGKHGANCGLKCLCANNGTCNAITG 685 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +2 Query: 257 DRYTRESRGFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQMA 385 D T+ S+G AFV++ + L D G LDG L+V +A Sbjct: 450 DHLTQHSKGSAFVKYRSAESVTQCLAATDEDSEGLFLDGNRLQVDLA 496 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 269 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 ++ +G + F +RD + AL +DG L+G+ +R+ Sbjct: 130 KQRQGEGVIEFSCKRDLKRALKKLDGEELNGKRIRL 165 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 159 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYI 251 +L V N+ TT DL+ FER GEV D+ I Sbjct: 250 TLFVGNIEKTTTYGDLKEAFERYGEVIDVDI 280 >SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 512 EQSDCGNGCGYDCASNYDGGNET*TCACD---RNDSCMAMRGDHIAPSEREVPCR 357 E+ G + YDG T D ND + M G H AP R++ C+ Sbjct: 316 EELSKSRGKSHPFDEQYDGDRNTQIALMDMPHENDVVVEMNGRHAAPRHRKIRCQ 370 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 533 PLELFESEQSDCGNGCGYDCASNYDGGNET*TCACDRNDSC 411 P L E C +GC +C+ N +G + + C+C C Sbjct: 1346 PSSLLELSTCGCKSGCQRNCSFNNNGLSCSEACSCIAGTDC 1386 >SB_6097| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.7) Length = 325 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +3 Query: 249 IPEIGTQGKVEDSPS*GFSSVVMLKKPWTR-WTDECWTAGNFAFRWRD 389 IP I G + P+ + + K P R WT G F ++WR+ Sbjct: 14 IPHISGHGYLSIPPARNYCGALKDKGPCVRNWTPNELNCGGFVYQWRE 61 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 275 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 376 S GF FV + DA++A+D ++G + + L+V Sbjct: 87 SYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKV 120 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +2 Query: 284 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 382 F FV+F + A+EA+ GR+++G+++ V++ Sbjct: 82 FGFVQFETEKGADEAVAKEHGRIINGKKIDVRI 114 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 385 RD+ + SRGF FV A++ M+ + GR + V +A Sbjct: 41 RDKESGRSRGFGFVLLQSADQIAPAIEKMNQSSVGGRNITVALA 84 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = +2 Query: 254 RDRYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 370 RD T+ SRGF F+ F + + + L++ + LDG+++ Sbjct: 141 RDPVTKRSRGFGFLTFKDPKAVDVVLNS-GAQELDGKKM 178 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,824,897 Number of Sequences: 59808 Number of extensions: 377375 Number of successful extensions: 952 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -