BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060427.seq (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13055| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) 29 2.6 >SB_13055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1140 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 33 LRSYHDTGHHEASMGRTWDRRDRVPRDHGHSR 128 +R YH T H + + DRR+R P + GH R Sbjct: 158 VRGYHKT-HERGPIEKMPDRRERSPYERGHER 188 >SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) Length = 979 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +1 Query: 37 DLIMTQGTMKPVWEELGTGETEYQGTMDILGRSLKPEKTDWSVNTCREISLN-LKLPGEI 213 D+ T T + +W+++ T L R + P+K D + N ++ N +L G + Sbjct: 34 DMEHTLDTQQEIWKDIKEDIASAHLTGTTLLRCISPDKNDENSNMTPDVKANTTELEGLL 93 Query: 214 WQLAHQETIFNRF 252 +L E F +F Sbjct: 94 QRLYQSEEDFGKF 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,438,536 Number of Sequences: 59808 Number of extensions: 442409 Number of successful extensions: 979 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 977 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -