BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060427.seq (682 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL391244-1|CAI22656.1| 473|Homo sapiens ATPase family, AAA doma... 32 1.6 AL157945-1|CAI22067.1| 473|Homo sapiens ATPase family, AAA doma... 32 1.6 AL136526-4|CAI39556.1| 111|Homo sapiens propionyl Coenzyme A ca... 32 1.6 >AL391244-1|CAI22656.1| 473|Homo sapiens ATPase family, AAA domain containing 3C protein. Length = 473 Score = 32.3 bits (70), Expect = 1.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 133 SLKPEKTDWSVNTCREISLNLKLPGE 210 S PE+ DW++N C ++ ++ LPG+ Sbjct: 278 SCHPEQFDWAINACIDVMVHFDLPGQ 303 >AL157945-1|CAI22067.1| 473|Homo sapiens ATPase family, AAA domain containing 3C protein. Length = 473 Score = 32.3 bits (70), Expect = 1.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +1 Query: 133 SLKPEKTDWSVNTCREISLNLKLPGE 210 S PE+ DW++N C ++ ++ LPG+ Sbjct: 278 SCHPEQFDWAINACIDVMVHFDLPGQ 303 >AL136526-4|CAI39556.1| 111|Homo sapiens propionyl Coenzyme A carboxylase, alpha polypeptide protein. Length = 111 Score = 32.3 bits (70), Expect = 1.6 Identities = 14/32 (43%), Positives = 21/32 (65%) Frame = -1 Query: 340 LSLKISDAMESTMSAAVCVFGTYPVA*NVEIC 245 +S+K DA S++S +C+F T+ VA EIC Sbjct: 40 VSVKPGDAATSSLSVEICLFWTFQVAEGQEIC 71 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,283,989 Number of Sequences: 237096 Number of extensions: 2284559 Number of successful extensions: 4215 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4036 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4215 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7727256732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -