BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060427.seq (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.2 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 224 PIKKPSSTDFYILRYWVCSKYTHSRRHCTLHGIT 325 PIK S + + R W Y ++ +H +H IT Sbjct: 103 PIKSLSLSIKMLERIWRPDTYFYNGKHSYVHTIT 136 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 Query: 197 SYLVKYGNWPIK 232 +YL+K+ NW +K Sbjct: 260 TYLIKWKNWDLK 271 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 460 HHPGCCPIPNGVSPTTENPH 401 H PG P G P + +PH Sbjct: 300 HSPGVYPSTAGFLPPSYHPH 319 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,493 Number of Sequences: 438 Number of extensions: 4019 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -