BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060426.seq (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.3 AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase l... 22 5.3 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/43 (23%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 284 VASIVINKLLENSMK-RISSFKTSNVWVTIFINKI*EYCAEKI 159 + +++ +L N R++S +W +I I K +C +K+ Sbjct: 279 IQEVMLFTILWNCQNTRVASEDFKAIWYSILIKKADSFCKKKL 321 >AF260820-1|AAG02018.1| 139|Tribolium castaneum alpha-esterase like protein E1 protein. Length = 139 Score = 21.8 bits (44), Expect = 5.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 255 RELHEKNFKLQDK*CLGYNIYK*NLR 178 R +KN + + CL N+Y NLR Sbjct: 41 RHFFKKNLIVGSENCLVLNVYTKNLR 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,244 Number of Sequences: 336 Number of extensions: 3698 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -