BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060426.seq (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 27 0.72 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 24 5.0 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 26.6 bits (56), Expect = 0.72 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 523 FKAPVVNQHILSLLNDQNTHILQG 452 F P +N HIL ++ QN+ +L G Sbjct: 402 FTDPRINMHILQMIRRQNSDMLHG 425 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 424 CLMSLSGHTTPVECVCFGHSEDLVCAGSQLVP 519 CL + GH P+ C E ++ GS L P Sbjct: 1068 CLRCMVGHDVPLNQGCLAPIEVIIPPGSILDP 1099 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,392 Number of Sequences: 2352 Number of extensions: 14023 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -