Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060425.seq
         (679 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0867 - 32586254-32586574,32586756-32587172                       28   6.0  

>01_06_0867 - 32586254-32586574,32586756-32587172
          Length = 245

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 505 YKASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNNHFSKNHP 657
           Y+A   IAD +YGS   I    H + ++ G L +L   + +L    +  HP
Sbjct: 116 YEAQARIADPVYGSVGTILALQHQVSLLQGQLSVLESQLFNLRVALASAHP 166


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,478,668
Number of Sequences: 37544
Number of extensions: 163968
Number of successful extensions: 297
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 295
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 297
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1726796312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)