Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV060421.seq
         (666 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    22   6.0  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    22   6.0  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    22   6.0  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    22   6.0  
AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.          22   6.0  

>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 418 ICVESGYVTFWLD 380
           I V S ++TFWL+
Sbjct: 313 ILVTSSFITFWLE 325


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 418 ICVESGYVTFWLD 380
           I V S ++TFWL+
Sbjct: 282 ILVTSSFITFWLE 294


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 418 ICVESGYVTFWLD 380
           I V S ++TFWL+
Sbjct: 333 ILVTSSFITFWLE 345


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 418 ICVESGYVTFWLD 380
           I V S ++TFWL+
Sbjct: 282 ILVTSSFITFWLE 294


>AY569711-1|AAS86664.1|  401|Apis mellifera feminizer protein.
          Length = 401

 Score = 21.8 bits (44), Expect = 6.0
 Identities = 13/50 (26%), Positives = 20/50 (40%)
 Frame = +3

Query: 72  IHTYENVGQKANKITVEHPKSREKIFGFRTCETCYSR*GWSGISPGRSFR 221
           I   EN  +   K  +     R +   F+   +C+SR   S    G S+R
Sbjct: 197 IEKSENETKTCKKYAISSNSLRSRSRSFQRTSSCHSRYEDSRHEDGNSYR 246


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 180,529
Number of Sequences: 438
Number of extensions: 3854
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20099475
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)