BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060420.seq (536 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 76 3e-16 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 6.0 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 75.8 bits (178), Expect = 3e-16 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 395 GKHTVHWFRKGXRIHDNPALREGIIDAVTFRCVFIIDP 508 GKHTVHWFRKG R+HDNP+LREG+ A TFRCVF++DP Sbjct: 20 GKHTVHWFRKGLRLHDNPSLREGLAGASTFRCVFVLDP 57 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 501 IIKTHRNVTASIMPSR 454 +I+ RNV S+MP+R Sbjct: 906 LIRPERNVRQSMMPTR 921 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,893 Number of Sequences: 438 Number of extensions: 2219 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15213684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -