BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060418.seq (552 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0003 + 13079-13610,14005-14312,14364-14549,14620-14707,148... 28 5.7 01_05_0466 - 22488026-22488427 27 10.0 >02_01_0003 + 13079-13610,14005-14312,14364-14549,14620-14707, 14807-14887,14980-15044,15357-15497,15578-15694, 15995-16237,16326-16383,18127-18224 Length = 638 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 292 ETKXSXAPETLPXPSAQAHXPARPXHMSAPRRT 390 E S +P LP P ++H P H APR+T Sbjct: 181 EGSGSQSPFLLPSPRYKSHSHRIPSHPIAPRKT 213 >01_05_0466 - 22488026-22488427 Length = 133 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 271 RMEIGAIETKXSXAPETLPXPSAQAHXPARPXHMSAPRRTP 393 R+ +GA APE +P P + PA P + RR P Sbjct: 72 RLNLGAAALHAGGAPEVVPRPLPPS--PASPRRLRRGRRLP 110 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,476,919 Number of Sequences: 37544 Number of extensions: 186630 Number of successful extensions: 381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -