BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060418.seq (552 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12072| Best HMM Match : rve (HMM E-Value=2.8e-17) 28 5.8 SB_39810| Best HMM Match : Pam16 (HMM E-Value=8.3) 27 7.7 >SB_12072| Best HMM Match : rve (HMM E-Value=2.8e-17) Length = 1693 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +1 Query: 271 RMEIGAIETKXSXAPETLPXPSAQAHXPARPXHMSAPRRTPGK 399 ++ A + S + P + H PARP PRRT K Sbjct: 609 KLRFNAGDKATSQGERSKRCPRGEVHHPARPFSADGPRRTVPK 651 >SB_39810| Best HMM Match : Pam16 (HMM E-Value=8.3) Length = 177 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 331 PSAQAHXPARPXHMSAPRRTPGK 399 P + H PARP PRRT K Sbjct: 140 PRGEVHHPARPFSADGPRRTVPK 162 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,859,037 Number of Sequences: 59808 Number of extensions: 229574 Number of successful extensions: 325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -