BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060417.seq (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U28944-3|AAN63455.1| 205|Caenorhabditis elegans Hypothetical pr... 29 4.1 U28944-2|AAL08028.1| 339|Caenorhabditis elegans Hypothetical pr... 29 4.1 U28944-1|AAA68368.1| 342|Caenorhabditis elegans Hypothetical pr... 29 4.1 U42843-7|AAA83598.2| 326|Caenorhabditis elegans Serpentine rece... 28 7.1 >U28944-3|AAN63455.1| 205|Caenorhabditis elegans Hypothetical protein C18A3.4c protein. Length = 205 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/37 (27%), Positives = 24/37 (64%) Frame = -3 Query: 323 IFVFYLPDNRIWMVNSLVSFEFIDGAHYLVLHIILHV 213 + Y+P R+W ++ L+SF + A ++++ ++LH+ Sbjct: 95 LVAMYMP--RVWFLSHLLSFLYFSFALWVIICLLLHI 129 >U28944-2|AAL08028.1| 339|Caenorhabditis elegans Hypothetical protein C18A3.4b protein. Length = 339 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/37 (27%), Positives = 24/37 (64%) Frame = -3 Query: 323 IFVFYLPDNRIWMVNSLVSFEFIDGAHYLVLHIILHV 213 + Y+P R+W ++ L+SF + A ++++ ++LH+ Sbjct: 95 LVAMYMP--RVWFLSHLLSFLYFSFALWVIICLLLHI 129 >U28944-1|AAA68368.1| 342|Caenorhabditis elegans Hypothetical protein C18A3.4a protein. Length = 342 Score = 28.7 bits (61), Expect = 4.1 Identities = 10/37 (27%), Positives = 24/37 (64%) Frame = -3 Query: 323 IFVFYLPDNRIWMVNSLVSFEFIDGAHYLVLHIILHV 213 + Y+P R+W ++ L+SF + A ++++ ++LH+ Sbjct: 95 LVAMYMP--RVWFLSHLLSFLYFSFALWVIICLLLHI 129 >U42843-7|AAA83598.2| 326|Caenorhabditis elegans Serpentine receptor, class d (delta)protein 5 protein. Length = 326 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 520 LCVPCWSYLDSFVITTPIFKWLDILTTRWQRY 425 L VP + + SF+ TP KW + T W+ Y Sbjct: 272 LFVPVLTPISSFIFVTPYRKWF-LKTCHWRNY 302 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,070,637 Number of Sequences: 27780 Number of extensions: 282706 Number of successful extensions: 611 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -