BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060416.seq (554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 24 2.9 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 24 3.9 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 24.2 bits (50), Expect = 2.9 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = -1 Query: 392 PTEGKPIKATRASPDFSTSKPSPLSPPFFEGSSNCDLYFANLAFKXP 252 P +G T+ S D P P SPP S ++ F+ F P Sbjct: 201 PPKGAGATGTQHS-DQQQEPPRPSSPPAIRRSGTLEVTFSERTFVTP 246 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 23.8 bits (49), Expect = 3.9 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = -1 Query: 392 PTEGKPIKATRASPDFSTSKPSPLSPPFFEGSSNCDLYFANLAFKXP 252 P +G T+ S D P P SPP S ++ F+ F P Sbjct: 201 PPKGAGATGTQHS-DQQQELPRPSSPPAIRRSGTLEVTFSERTFVTP 246 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,317 Number of Sequences: 2352 Number of extensions: 7680 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -