BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV060415.seq (567 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 24 0.93 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.6 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 6.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 8.6 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 8.6 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 8.6 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 24.2 bits (50), Expect = 0.93 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 288 GSGYLFCSVPHPYIRVLLSHTDHHALMAGPSHDRGEHGARSIISC 154 GS Y+ VP RVLL+ TD + S D E+G +C Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYGIIGPTTC 373 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 369 LRVAPEXHPVLLTEAPLNPKANXEKM 446 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 133 GMCKAGFAGD 162 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 192 DRGEHGARSIISCETGLA 139 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 530 YDRTRTAXHGLDGDVHGGRVECF 462 YDR T LDG + G+V F Sbjct: 143 YDRYSTIARPLDGKLSRGQVILF 165 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 192 DRGEHGARSIISCETGLA 139 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,280 Number of Sequences: 438 Number of extensions: 3581 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -